Clone LD18389 Report

Search the DGRC for LD18389

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:183
Well:89
Vector:pBS SK-
Associated Gene/TranscriptCG6171-RA
Protein status:LD18389.pep: gold
Preliminary Size:1135
Sequenced Size:967

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6171 2003-02-27 Blastp of sequenced clone
CG6171 2008-04-29 Release 5.5 accounting
CG6171 2008-08-15 Release 5.9 accounting
CG6171 2008-12-18 5.12 accounting

Clone Sequence Records

LD18389.complete Sequence

967 bp (967 high quality bases) assembled on 2003-02-27

GenBank Submission: BT004895

> LD18389.complete
TAAAAATGTTTTGAAAATTTAACTTAATTTACTTAAAATGAGTGCCACAG
ATGCATCTACAGCCGATAGTGGCGCTAAACGAAAATCTTCTGAAGATATC
ACACACAATTGCAACGCAAATTTTGGCGCAGAAAACGGCCTAAGAAAGCG
CGTAAAATCGGAGGAGCCTGTGGCGTCCATTAAAGATGAAACAAATCCTG
AAGTTCCTATGAAAATAAAAGCTGAGCCAGTGGAGAATGCAGATGAGCCC
ACAAGCACTACTCCTGCGATCAAGATTAAAGCCGAACCAGCGGACAATGG
AAACTCACCTGCAGCTGCGATGGTAAAAACCGAGCCCACTAATAGCAATG
CACAGGACGCCGCCGACGAGTCTACCGTATCTTCAAGCAGTATTAGGACT
TCTTGTCGCTTCGGCATACGATGCTACAGGCGAAATCCAGCTCATCGTAG
TGCAGAAGCTCATCCGGGGGATCAGGATTACCGGCGACCAAACTTTCCAG
CGCCACCCCTCGGAACTCCAGCTTGTCCTTTCGGTAACGCATGCTATCGC
CGTAACCCAGTTCACTTCCAGGATTACTCCCATCCTGCGGATTGTAAGTA
GAAGGCTTGGCATACTTCGGCTTCAAATTGGCTAAAGCCCATTGTAGTCA
ATTCCGCGCAGAACATTCGAAATCGTCTGCGTCAACGGCGAGCCCAACGG
CAGAACGACGATGACTCGGGGACGGATGAGGAGGATGAACCCTTTGGTGG
CGACAATGACAGGGATGCGGACTACCGTCCAGGCGCAGACATAAACGAAG
ATGAGGATGATGAGCTGGAGTTTGATAGCCAACCAATAAGTGGGGATGAC
TATGATTAGACTATAAATTCAAATTCGCTGTTAACTTAGATGATACGTTC
CATTTGCCGAATAATAGGCTTTATATATATATATTATATTCTGTTGATGA
AAAAAAAAAAAAAAAAA

LD18389.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG6171-RA 1079 CG6171-RA 127..1079 1..953 4765 100 Plus
CG6171-RB 1025 CG6171-RB 127..719 1..593 2965 100 Plus
CG34404.c 3143 CG34404.c 2683..3112 1..430 2150 100 Plus
CG6171-RB 1025 CG6171-RB 720..1025 648..953 1530 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:51:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11187431..11187954 949..426 2620 100 Minus
chr3R 27901430 chr3R 11188011..11188440 430..1 2150 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:05:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15362792..15363319 953..426 2640 100 Minus
3R 32079331 3R 15363376..15363805 430..1 2150 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15103623..15104150 953..426 2640 100 Minus
3R 31820162 3R 15104207..15104636 430..1 2150 100 Minus
Blast to na_te.dros performed on 2019-03-16 11:51:18 has no hits.

LD18389.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:52:11 Download gff for LD18389.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11187431..11187950 430..949 100 <- Minus
chr3R 11188012..11188440 1..429 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:53:01 Download gff for LD18389.complete
Subject Subject Range Query Range Percent Splice Strand
CG6171-RA 1..564 38..601 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:47:20 Download gff for LD18389.complete
Subject Subject Range Query Range Percent Splice Strand
CG6171-RA 1..564 38..601 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:33:39 Download gff for LD18389.complete
Subject Subject Range Query Range Percent Splice Strand
CG6171-RA 1..564 38..601 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:38:46 Download gff for LD18389.complete
Subject Subject Range Query Range Percent Splice Strand
CG6171-RA 1..564 38..601 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:28:19 Download gff for LD18389.complete
Subject Subject Range Query Range Percent Splice Strand
CG6171-RA 1..564 38..601 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:59:15 Download gff for LD18389.complete
Subject Subject Range Query Range Percent Splice Strand
CG6171-RA 127..1075 1..949 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:47:20 Download gff for LD18389.complete
Subject Subject Range Query Range Percent Splice Strand
CG6171-RA 127..1075 1..949 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:33:39 Download gff for LD18389.complete
Subject Subject Range Query Range Percent Splice Strand
CG6171-RA 53..1001 1..949 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:38:46 Download gff for LD18389.complete
Subject Subject Range Query Range Percent Splice Strand
CG6171-RA 127..1075 1..949 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:28:19 Download gff for LD18389.complete
Subject Subject Range Query Range Percent Splice Strand
CG6171-RA 53..1001 1..949 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:52:11 Download gff for LD18389.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15362796..15363315 430..949 100 <- Minus
3R 15363377..15363805 1..429 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:52:11 Download gff for LD18389.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15362796..15363315 430..949 100 <- Minus
3R 15363377..15363805 1..429 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:52:11 Download gff for LD18389.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15362796..15363315 430..949 100 <- Minus
3R 15363377..15363805 1..429 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:33:39 Download gff for LD18389.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11188518..11189037 430..949 100 <- Minus
arm_3R 11189099..11189527 1..429 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:09:04 Download gff for LD18389.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15103627..15104146 430..949 100 <- Minus
3R 15104208..15104636 1..429 100   Minus

LD18389.hyp Sequence

Translation from 37 to 600

> LD18389.hyp
MSATDASTADSGAKRKSSEDITHNCNANFGAENGLRKRVKSEEPVASIKD
ETNPEVPMKIKAEPVENADEPTSTTPAIKIKAEPADNGNSPAAAMVKTEP
TNSNAQDAADESTVSSSSIRTSCRFGIRCYRRNPAHRSAEAHPGDQDYRR
PNFPAPPLGTPACPFGNACYRRNPVHFQDYSHPADCK*

LD18389.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:08:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG6171-PA 187 CG6171-PA 1..187 1..187 1000 100 Plus
CG6171-PB 255 CG6171-PB 1..185 1..185 986 100 Plus

LD18389.pep Sequence

Translation from 37 to 600

> LD18389.pep
MSATDASTADSGAKRKSSEDITHNCNANFGAENGLRKRVKSEEPVASIKD
ETNPEVPMKIKAEPVENADEPTSTTPAIKIKAEPADNGNSPAAAMVKTEP
TNSNAQDAADESTVSSSSIRTSCRFGIRCYRRNPAHRSAEAHPGDQDYRR
PNFPAPPLGTPACPFGNACYRRNPVHFQDYSHPADCK*

LD18389.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16707-PA 296 GF16707-PA 7..220 2..185 410 46.8 Plus
Dana\GF24665-PA 176 GF24665-PA 36..100 119..185 296 79.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20607-PA 207 GG20607-PA 15..207 2..187 712 76.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19483-PA 306 GH19483-PA 98..228 56..185 402 58.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG6171-PA 187 CG6171-PA 1..187 1..187 1000 100 Plus
CG6171-PB 255 CG6171-PB 1..185 1..185 986 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:59:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22254-PA 324 GI22254-PA 153..247 90..185 409 74 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:59:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13753-PA 303 GL13753-PA 98..224 58..183 429 64.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:59:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19407-PB 234 GA19407-PB 98..228 58..187 454 65.6 Plus
Dpse\GA19407-PA 303 GA19407-PA 98..224 58..183 440 66.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:59:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25777-PA 204 GM25777-PA 15..204 2..187 792 82.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:59:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20355-PA 204 GD20355-PA 21..204 8..187 754 82.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:59:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24045-PA 305 GJ24045-PA 63..226 38..185 417 54.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:59:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11307-PA 300 GK11307-PA 26..207 10..186 422 53.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:59:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26382-PA 275 GE26382-PA 16..205 3..185 659 73.7 Plus