Clone LD18692 Report

Search the DGRC for LD18692

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:186
Well:92
Vector:pBS SK-
Associated Gene/TranscriptGstE11-RA
Protein status:LD18692.pep: gold
Preliminary Size:942
Sequenced Size:751

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5224 2001-01-01 Release 2 assignment
CG5224 2002-05-17 Blastp of sequenced clone
CG5224 2003-01-01 Sim4 clustering to Release 3
CG5224 2008-04-29 Release 5.5 accounting
CG5224 2008-08-15 Release 5.9 accounting
CG5224 2008-12-18 5.12 accounting

Clone Sequence Records

LD18692.complete Sequence

751 bp (751 high quality bases) assembled on 2002-05-17

GenBank Submission: AY118522

> LD18692.complete
GGTTGCATTTTAGTTCAACGAGAAACTGCTTGTACTATGTCGGCCAAACC
CATCCTCTATTACGCTCCCCGTAGTCCCCCCTGTCGTGCTGTTCTGCTGA
CGGCCGCCGCCCTCGGTTTGGAGTTGGACTTGCGACTGGTCAACGTAAAG
GCCGGAGAGCACAAATCCGCCGAGTTTCTCAAGTTGAATGCGCAGCACAC
GATCCCCGTGCTCGATGATAACGGCACCATCGTGAGCGATTCGCACATTA
TCTGCAGCTATCTGGCAGATAAGTACGCACCGGAGGGCGATGATTCCCTG
TATCCAAAGGATCCGGAGAAGCGGCGCCTGGTGGATGCCCGTTTGTACTA
CGATTGCGGTCATCTATTCCCGCGAATCCGTTTCATTGTCGAGCCGGTGA
TCTATTTCGGAGCTGGCGAGGTGCCCAGCGATCGAGTGGCCTACCTTCAG
AAGGCCTATGATGGCTTGGAGCACTGTCTGGCTGAAGGTGATTACTTGGT
GGGCGACAAGCTGACCATCGCCGATCTCAGCTGCATCGCATCGGTGTCCA
CGGCCGAGGCTTTTGCGCCAATCGAGCCGGATCAGTTTCCACGCCTGGTA
CAGTGGGTCAAGCGCATTCAGGCCCTTCCATACTACCAGAAAAACAATCA
GGAAGGTCTGGATATGTTGGTGGGACTGGTTAAGGGACTTTTGGCTGAGC
GACAGCAGAAGTAATATAAACGGTTTTTATTCGAAAAAAAAAAAAAAAAA
A

LD18692.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG5224-RA 1025 CG5224-RA 45..780 1..736 3680 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14391353..14391952 134..733 2925 99.2 Plus
chr2R 21145070 chr2R 14390849..14390957 26..134 545 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:06:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:30:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18504245..18504847 134..736 3015 100 Plus
2R 25286936 2R 18503741..18503849 26..134 545 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18505444..18506046 134..736 3015 100 Plus
2R 25260384 2R 18504940..18505048 26..134 545 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:30:29 has no hits.

LD18692.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:31:17 Download gff for LD18692.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14390745..14390769 1..25 100 -> Plus
chr2R 14390849..14390957 26..134 100 -> Plus
chr2R 14391354..14391952 135..733 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:53:12 Download gff for LD18692.complete
Subject Subject Range Query Range Percent Splice Strand
CG5224-RA 1..678 37..714 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:59 Download gff for LD18692.complete
Subject Subject Range Query Range Percent Splice Strand
CG5224-RA 1..678 37..714 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:52:08 Download gff for LD18692.complete
Subject Subject Range Query Range Percent Splice Strand
GstE11-RA 1..678 37..714 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:26 Download gff for LD18692.complete
Subject Subject Range Query Range Percent Splice Strand
CG5224-RA 1..678 37..714 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:42:47 Download gff for LD18692.complete
Subject Subject Range Query Range Percent Splice Strand
GstE11-RA 1..678 37..714 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:05:00 Download gff for LD18692.complete
Subject Subject Range Query Range Percent Splice Strand
CG5224-RA 28..760 1..733 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:59 Download gff for LD18692.complete
Subject Subject Range Query Range Percent Splice Strand
CG5224-RA 28..760 1..733 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:52:08 Download gff for LD18692.complete
Subject Subject Range Query Range Percent Splice Strand
GstE11-RA 30..762 1..733 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:26 Download gff for LD18692.complete
Subject Subject Range Query Range Percent Splice Strand
CG5224-RA 28..760 1..733 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:42:47 Download gff for LD18692.complete
Subject Subject Range Query Range Percent Splice Strand
GstE11-RA 30..762 1..733 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:31:17 Download gff for LD18692.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18503637..18503661 1..25 100 -> Plus
2R 18503741..18503849 26..134 100 -> Plus
2R 18504246..18504844 135..733 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:31:17 Download gff for LD18692.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18503637..18503661 1..25 100 -> Plus
2R 18503741..18503849 26..134 100 -> Plus
2R 18504246..18504844 135..733 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:31:17 Download gff for LD18692.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18503637..18503661 1..25 100 -> Plus
2R 18503741..18503849 26..134 100 -> Plus
2R 18504246..18504844 135..733 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:52:08 Download gff for LD18692.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14391142..14391166 1..25 100 -> Plus
arm_2R 14391246..14391354 26..134 100 -> Plus
arm_2R 14391751..14392349 135..733 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:17:42 Download gff for LD18692.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18505445..18506043 135..733 100   Plus
2R 18504836..18504860 1..25 100 -> Plus
2R 18504940..18505048 26..134 100 -> Plus

LD18692.hyp Sequence

Translation from 0 to 713

> LD18692.hyp
GCILVQRETACTMSAKPILYYAPRSPPCRAVLLTAAALGLELDLRLVNVK
AGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHIICSYLADKYAPEGDDSL
YPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPSDRVAYLQ
KAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLV
QWVKRIQALPYYQKNNQEGLDMLVGLVKGLLAERQQK*

LD18692.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:26:16
Subject Length Description Subject Range Query Range Score Percent Strand
GstE11-PB 225 CG5224-PB 1..225 13..237 1172 100 Plus
GstE11-PA 225 CG5224-PA 1..225 13..237 1172 100 Plus
GstE12-PC 223 CG16936-PC 2..223 15..237 566 49.3 Plus
GstE12-PB 223 CG16936-PB 2..223 15..237 566 49.3 Plus
GstE12-PD 223 CG16936-PD 2..223 15..237 566 49.3 Plus

LD18692.pep Sequence

Translation from 36 to 713

> LD18692.pep
MSAKPILYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKL
NAQHTIPVLDDNGTIVSDSHIICSYLADKYAPEGDDSLYPKDPEKRRLVD
ARLYYDCGHLFPRIRFIVEPVIYFGAGEVPSDRVAYLQKAYDGLEHCLAE
GDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQWVKRIQALPYY
QKNNQEGLDMLVGLVKGLLAERQQK*

LD18692.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11968-PA 972 GF11968-PA 1..218 1..218 1022 85.3 Plus
Dana\GF13293-PA 223 GF13293-PA 2..223 3..225 570 50.7 Plus
Dana\GF12163-PA 220 GF12163-PA 2..212 3..215 463 43.7 Plus
Dana\GF12168-PA 219 GF12168-PA 5..217 6..220 454 42.3 Plus
Dana\GF12166-PA 220 GF12166-PA 2..201 3..204 445 44.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:45:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21901-PA 225 GG21901-PA 1..225 1..225 1121 94.2 Plus
Dere\GG19896-PA 223 GG19896-PA 2..223 3..225 568 49.8 Plus
Dere\GG21883-PA 220 GG21883-PA 2..214 3..217 454 44.2 Plus
Dere\GG21885-PA 219 GG21885-PA 5..217 6..220 448 43.3 Plus
Dere\GG20973-PA 240 GG20973-PA 5..224 6..225 448 42.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:45:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19714-PA 221 GH19714-PA 1..221 1..222 835 67.6 Plus
Dgri\GH21542-PA 224 GH21542-PA 2..222 3..224 617 53.6 Plus
Dgri\GH15974-PA 219 GH15974-PA 3..214 4..217 456 42.5 Plus
Dgri\GH21671-PA 221 GH21671-PA 2..213 3..215 444 43.5 Plus
Dgri\GH21668-PA 217 GH21668-PA 2..217 3..220 440 44.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
GstE11-PB 225 CG5224-PB 1..225 1..225 1172 100 Plus
GstE11-PA 225 CG5224-PA 1..225 1..225 1172 100 Plus
GstE12-PC 223 CG16936-PC 2..223 3..225 566 49.3 Plus
GstE12-PB 223 CG16936-PB 2..223 3..225 566 49.3 Plus
GstE12-PD 223 CG16936-PD 2..223 3..225 566 49.3 Plus
GstE12-PA 223 CG16936-PA 2..223 3..225 566 49.3 Plus
GstE3-PA 220 CG17524-PA 3..213 4..216 443 43.2 Plus
GstE10-PB 240 CG17522-PB 2..224 3..225 440 42.2 Plus
GstE10-PA 240 CG17522-PA 2..224 3..225 440 42.2 Plus
GstE9-PA 221 CG17534-PA 3..212 4..214 438 45.3 Plus
GstE6-PA 222 CG17530-PA 3..214 4..216 431 42.5 Plus
GstE5-PA 222 CG17527-PA 3..214 4..216 430 41.6 Plus
GstE7-PA 223 CG17531-PA 3..205 4..207 423 44.4 Plus
GstE2-PA 221 CG17523-PA 1..217 1..219 421 40.2 Plus
GstE1-PA 224 CG5164-PA 1..215 1..216 415 40.1 Plus
GstE13-PB 226 CG11784-PB 2..224 3..225 409 39.6 Plus
GstE13-PA 226 CG11784-PA 2..224 3..225 409 39.6 Plus
GstE4-PA 222 CG17525-PA 6..214 7..216 405 37.9 Plus
GstE8-PB 222 CG17533-PB 2..214 3..216 397 40.5 Plus
GstE8-PA 222 CG17533-PA 2..214 3..216 397 40.5 Plus
GstD1-PB 209 CG10045-PB 5..197 8..203 365 40.2 Plus
GstD1-PA 209 CG10045-PA 5..197 8..203 365 40.2 Plus
GstD8-PA 212 CG4421-PA 4..212 8..224 364 39.3 Plus
GstD4-PA 215 CG11512-PA 4..200 8..208 341 38.1 Plus
GstD5-PA 216 CG12242-PA 4..216 8..224 338 34.6 Plus
GstD7-PA 224 CG4371-PA 6..221 7..225 332 35.6 Plus
GstD9-PB 218 CG10091-PB 5..218 8..223 331 35 Plus
GstD9-PA 218 CG10091-PA 5..218 8..223 331 35 Plus
GstD2-PA 215 CG4181-PA 4..200 8..208 323 37.1 Plus
GstD11-PA 222 CG17639-PA 4..214 5..216 321 35.3 Plus
GstD11-PB 243 CG17639-PB 25..235 5..216 321 35.3 Plus
GstD6-PA 215 CG4423-PA 3..196 7..203 313 37.4 Plus
GstE14-PA 232 CG4688-PA 5..201 4..203 313 36.3 Plus
GstD10-PB 210 CG18548-PB 3..197 7..203 304 35.8 Plus
GstD10-PA 210 CG18548-PA 3..197 7..203 304 35.8 Plus
GstD3-PA 199 CG4381-PA 1..195 21..223 278 31.7 Plus
gfzf-PD 234 CG33546-PD 3..184 7..190 238 35.5 Plus
gfzf-PE 1045 CG33546-PE 814..995 7..190 238 35.5 Plus
gfzf-PB 1045 CG33546-PB 814..995 7..190 238 35.5 Plus
GstT2-PA 228 CG30005-PA 2..211 3..202 156 26.2 Plus
GstT3-PC 228 CG1702-PC 1..209 1..200 144 26.4 Plus
GstT3-PA 228 CG1702-PA 1..209 1..200 144 26.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:45:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20133-PA 225 GI20133-PA 8..225 4..222 921 75.8 Plus
Dmoj\GI19515-PA 223 GI19515-PA 2..223 3..225 596 52 Plus
Dmoj\GI16624-PA 219 GI16624-PA 2..217 3..220 457 41.3 Plus
Dmoj\GI16623-PA 219 GI16623-PA 2..214 3..217 457 40.9 Plus
Dmoj\GI20124-PA 221 GI20124-PA 2..212 3..214 454 44.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:45:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17783-PA 226 GL17783-PA 1..224 1..225 985 82.2 Plus
Dper\GL17702-PA 223 GL17702-PA 2..223 3..225 575 50.7 Plus
Dper\GL17769-PA 219 GL17769-PA 5..217 6..220 450 43.7 Plus
Dper\GL17770-PA 222 GL17770-PA 2..215 3..216 434 41.1 Plus
Dper\GL17773-PA 222 GL17773-PA 3..214 4..216 433 41.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:45:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18748-PA 226 GA18748-PA 1..224 1..225 986 82.7 Plus
Dpse\GA14226-PA 223 GA14226-PA 2..223 3..225 577 50.7 Plus
Dpse\GA14540-PA 219 GA14540-PA 5..217 6..220 446 43.7 Plus
Dpse\GA14539-PA 241 GA14539-PA 5..225 6..225 435 42.6 Plus
Dpse\GA14545-PA 222 GA14545-PA 3..214 4..216 433 40.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:45:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21891-PA 225 GM21891-PA 1..225 1..225 1151 97.8 Plus
Dsec\GM11796-PA 223 GM11796-PA 2..223 3..225 572 50.2 Plus
Dsec\GM21878-PA 219 GM21878-PA 6..217 7..220 459 44.4 Plus
Dsec\GM21876-PA 220 GM21876-PA 2..214 3..217 456 43.3 Plus
Dsec\GM21881-PA 223 GM21881-PA 3..214 4..216 432 42.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:45:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11388-PA 251 GD11388-PA 48..251 22..225 1049 98 Plus
Dsim\GD24922-PA 213 GD24922-PA 2..213 3..225 509 46.2 Plus
Dsim\GD11372-PA 219 GD11372-PA 5..217 6..220 451 43.3 Plus
Dsim\GD11376-PA 223 GD11376-PA 3..214 4..216 444 42.5 Plus
Dsim\GD25394-PA 240 GD25394-PA 5..224 6..225 438 42.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:45:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19903-PA 228 GJ19903-PA 7..228 2..224 923 74.4 Plus
Dvir\GJ21084-PA 223 GJ21084-PA 2..223 3..225 595 52 Plus
Dvir\GJ12879-PA 219 GJ12879-PA 5..217 6..220 486 44.2 Plus
Dvir\GJ22450-PA 238 GJ22450-PA 4..222 6..225 461 43 Plus
Dvir\GJ19894-PA 221 GJ19894-PA 2..219 3..221 452 42.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:45:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23004-PA 226 GK23004-PA 1..224 1..224 941 76.3 Plus
Dwil\GK21654-PA 223 GK21654-PA 2..223 3..225 562 48.9 Plus
Dwil\GK22985-PA 219 GK22985-PA 2..217 3..220 483 45.9 Plus
Dwil\GK22984-PA 220 GK22984-PA 2..214 3..217 458 44.2 Plus
Dwil\GK22987-PA 219 GK22987-PA 5..217 6..220 455 43.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:45:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11975-PA 225 GE11975-PA 1..225 1..225 1132 95.1 Plus
Dyak\GE11420-PA 223 GE11420-PA 2..223 3..225 566 50.2 Plus
Dyak\GE11960-PA 219 GE11960-PA 5..217 6..220 459 44.7 Plus
Dyak\GstE3-PA 220 GE11958-PA 2..214 3..217 456 43.7 Plus
Dyak\GE13914-PA 240 GE13914-PA 5..224 6..225 439 41.4 Plus