Clone LD18757 Report

Search the DGRC for LD18757

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:187
Well:57
Vector:pBS SK-
Associated Gene/TranscriptCG10214-RA
Protein status:LD18757.pep: gold
Preliminary Size:1125
Sequenced Size:953

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10214 2001-01-01 Release 2 assignment
CG10214 2001-10-10 Blastp of sequenced clone
CG10214 2003-01-01 Sim4 clustering to Release 3
CG10214 2008-04-29 Release 5.5 accounting
CG10214 2008-08-15 Release 5.9 accounting
CG10214 2008-12-18 5.12 accounting

Clone Sequence Records

LD18757.complete Sequence

953 bp (953 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061251

> LD18757.complete
TAAAACCGCCGCATATTTACATTTAGCAAAAAGAAACCTGCGCTACAGCT
ATATATGCTTGCTCACCTTCGACGCGTCGGATTGTCCCTGAACCGCCAAA
TTCGGAGCCACATCGCATTCAATTCAAATGACAGAATGAGCAGCACCTGT
GGCTTAGACACGGACATCGTGTGGATGGACTTGGAGATGACCGGGCTGGA
CATTGAAAAGGACAAAATCCTCGAGGTGGCCTGCATCATTACGGACCAGG
ACCTGAACGTGAAGTCGGAGGGACCATGCTTTGCCATCAACCATCCGCAG
GAGGTCTACGACTCGATGAACGAGTGGTGCATGAAACATCATTACAATTC
AGGTCTTATTGATCGATGCAAGAGCTCGGATGTGAATCTCGAAGAAGCCT
CCAATCTAGTGCTATCCTATCTCGAGAAGAACATACCAAAGCGCGCCTGT
CCGCTTGGTGGGAACTCCGTCTACACCGACCGACTATTCATTATGAAATT
CATGCCATTGGTAGATGCTTACCTGCATTACCGCATCGTCGATGTGTCCA
CCATCAAGGAACTGGCCAAGCGATGGCATCCCGCAATTCTGGATTCCGCT
CCCAAAAAATCTTTCACGCATCGTAGTCTGGACGACATCCGAGAAAGCAT
CAAAGAGCTTGCGTATTACAAAGCGAACTTATTTAAATAAATTAAAGCAA
GAATTTAAAGCACCCTAGGAATTCTTTCAATACCTAATGCTTTATTGGCA
ATATGAGTCTATAATAATTTTGGATAAAAGTCCGCGTTGTATTGTTAAGC
GTGAAGTTAGGCTTATATTATTGACAAATGCATTATGTTAAAAATAGATG
TACAATATCGTTTAGTGTATTTTCCGTATATGCACGGAGAAACAGAAATA
AAAATACGATAGCAATAAAGAATTCAATGCTAGTAAAAAAAAAAAAAAAA
AAA

LD18757.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG10214-RA 934 CG10214-RA 1..934 1..934 4670 100 Plus
Lsd-1-RB 1576 Lsd-1-RB 1363..1576 935..722 1070 100 Minus
Lsd-1.a 1879 Lsd-1.a 1666..1879 935..722 1070 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19589918..19590865 934..1 4465 98.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:06:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:55:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23766518..23767452 935..1 4675 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23507349..23508283 935..1 4675 100 Minus
Blast to na_te.dros performed 2019-03-16 11:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
hobo 2959 hobo DMHFL1 2959bp Derived from M69216 (g157606) (Rel. 41, Last updated, Version 3). 1376..1429 421..475 110 69.1 Plus

LD18757.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:57:16 Download gff for LD18757.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19589918..19589952 900..934 100 -> Minus
chr3R 19589967..19590865 1..899 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:53:18 Download gff for LD18757.complete
Subject Subject Range Query Range Percent Splice Strand
CG10214-RA 1..636 55..690 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:49:30 Download gff for LD18757.complete
Subject Subject Range Query Range Percent Splice Strand
CG10214-RA 1..636 55..690 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:42:45 Download gff for LD18757.complete
Subject Subject Range Query Range Percent Splice Strand
CG10214-RA 1..636 55..690 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:18:17 Download gff for LD18757.complete
Subject Subject Range Query Range Percent Splice Strand
CG10214-RA 1..636 55..690 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:30:25 Download gff for LD18757.complete
Subject Subject Range Query Range Percent Splice Strand
CG10214-RA 1..636 55..690 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:33:50 Download gff for LD18757.complete
Subject Subject Range Query Range Percent Splice Strand
CG10214-RA 1..934 1..934 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:49:30 Download gff for LD18757.complete
Subject Subject Range Query Range Percent Splice Strand
CG10214-RA 1..934 1..934 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:42:45 Download gff for LD18757.complete
Subject Subject Range Query Range Percent Splice Strand
CG10214-RA 37..970 1..934 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:18:17 Download gff for LD18757.complete
Subject Subject Range Query Range Percent Splice Strand
CG10214-RA 1..934 1..934 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:30:25 Download gff for LD18757.complete
Subject Subject Range Query Range Percent Splice Strand
CG10214-RA 37..970 1..934 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:57:16 Download gff for LD18757.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23766519..23767452 1..934 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:57:16 Download gff for LD18757.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23766519..23767452 1..934 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:57:16 Download gff for LD18757.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23766519..23767452 1..934 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:42:45 Download gff for LD18757.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19592241..19593174 1..934 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:55:14 Download gff for LD18757.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23507350..23508283 1..934 100   Minus

LD18757.hyp Sequence

Translation from 54 to 689

> LD18757.hyp
MLAHLRRVGLSLNRQIRSHIAFNSNDRMSSTCGLDTDIVWMDLEMTGLDI
EKDKILEVACIITDQDLNVKSEGPCFAINHPQEVYDSMNEWCMKHHYNSG
LIDRCKSSDVNLEEASNLVLSYLEKNIPKRACPLGGNSVYTDRLFIMKFM
PLVDAYLHYRIVDVSTIKELAKRWHPAILDSAPKKSFTHRSLDDIRESIK
ELAYYKANLFK*

LD18757.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:43:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG10214-PA 211 CG10214-PA 1..211 1..211 1113 100 Plus

LD18757.pep Sequence

Translation from 54 to 689

> LD18757.pep
MLAHLRRVGLSLNRQIRSHIAFNSNDRMSSTCGLDTDIVWMDLEMTGLDI
EKDKILEVACIITDQDLNVKSEGPCFAINHPQEVYDSMNEWCMKHHYNSG
LIDRCKSSDVNLEEASNLVLSYLEKNIPKRACPLGGNSVYTDRLFIMKFM
PLVDAYLHYRIVDVSTIKELAKRWHPAILDSAPKKSFTHRSLDDIRESIK
ELAYYKANLFK*

LD18757.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:14:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18739-PA 187 GF18739-PA 3..187 27..211 766 74.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:14:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12405-PA 184 GG12405-PA 1..184 28..211 831 82.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11306-PA 187 GH11306-PA 1..187 28..211 673 66.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG10214-PA 211 CG10214-PA 1..211 1..211 1113 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22396-PA 187 GI22396-PA 2..187 30..211 688 65.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24271-PA 187 GL24271-PA 3..187 29..211 715 70.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10162-PA 187 GA10162-PA 3..187 29..211 715 70.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:14:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23540-PA 184 GM23540-PA 1..184 28..211 893 91.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:14:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18354-PA 208 GD18354-PA 2..208 5..211 995 90.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:14:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24646-PA 187 GJ24646-PA 6..187 30..211 674 65.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:14:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22765-PA 190 GK22765-PA 12..190 33..211 692 67.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:14:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23924-PA 184 GE23924-PA 1..184 28..211 850 84.8 Plus