Clone LD18769 Report

Search the DGRC for LD18769

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:187
Well:69
Vector:pBS SK-
Associated Gene/TranscriptCG4594-RA
Protein status:LD18769.pep: gold
Preliminary Size:1202
Sequenced Size:1022

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4594 2001-01-01 Release 2 assignment
CG4594 2001-10-10 Blastp of sequenced clone
CG4594 2003-01-01 Sim4 clustering to Release 3
CG4594 2008-04-29 Release 5.5 accounting
CG4594 2008-08-15 Release 5.9 accounting
CG4594 2008-12-18 5.12 accounting

Clone Sequence Records

LD18769.complete Sequence

1022 bp (1022 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061252

> LD18769.complete
TCATCTTCCATACTTAAAGAAAGATGCTGCGCTCAAATTTCTTAAGATTG
ATGGCCCACGGGGCTCCAAGTAGATTAATGTCCACCGCCACCAAGCTGAC
CACAGTGGAGATCAACGATAAGACAGGAATCGCTACTCTCACGATGAACC
GGCCTCCGGTGAATAGCCAAAATGTCCAGCTGCTTTTGGACCTGCAGACT
TCCATTAGCGAAATTGAGAACAATAAAAGTCGGGGTCTCATTTTAACCTC
TGCCAGCTCCAATGTGTTCTCAGCTGGCCTGGACATCTTTGAAATGTATA
ACACAGACGTGGAGCGACTCCGAACCGTTTGGACCGAATTGCAGAATGTA
TGGATTGCCCTCTATGGAACAACTTTGCCCACGGCAGCAGCCATCAATGG
CCACGCCCCCGCTGGCGGTTGCCTGCTGGCCACTGCCTGTGAGTATCGAG
TGATGCGGCCCAACTTTTTGATTGGATTAAACGAAGCCCAACTAGGAATC
ATTGCACCCAAGTGGCTAATGTCCGGCTTCGCTAGCATACTGCCCAAACG
GGTGGCAGAGCGAGCTCTCACCCAAGGACGTATGTTCACCACACAGGAGG
CCTTTGAAGTTGGCCTGATCGATGAGATCGCCAGCAGCAAGGAAGAGGCC
TTGGAGAAGTGCGCTGCCTTCATCGGCACCTTTGCTAAGGTCAATCCTTT
GGCCCGCGGACTGACCAAGCTCCAGTTCCGTGGCGACAACATTAAGGAGT
TTGAGATGATTCGCGAGAAAGATATTGCTGACTTTGTAGCTCTAGCTTCT
AGCCCGGGAGTGCAGAAGGTTATGGGAGCTTATCTTGAAAACCTAAAGAA
CAAGGTCAAGAAATAGTACACCTAACTTTGTAATTTGTAATGTTGATCTT
TTTACGTGCATTTAAACTGGAACTATTCGTCCAAAGTCCCTTAATTTGTT
AATTTAAAAAATTGTTTATATGTTAACCTAAAAATAAATAAAATTCCTGA
TGATAAAAAAAAAAAAAAAAAA

LD18769.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG4594-RA 1038 CG4594-RA 24..1031 1..1008 5040 100 Plus
CG4594.a 1235 CG4594.a 221..1228 1..1008 5040 100 Plus
CG4598-RA 1243 CG4598-RA 178..264 78..164 270 87.3 Plus
CG4598-RA 1243 CG4598-RA 667..830 567..730 250 76.8 Plus
CG4598-RA 1243 CG4598-RA 478..567 378..467 180 80 Plus
CG4598-RA 1243 CG4598-RA 288..377 188..277 150 77.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9919775..9920380 399..1004 3015 99.8 Plus
chr2L 23010047 chr2L 9919272..9919523 1..252 1260 100 Plus
chr2L 23010047 chr2L 9919575..9919722 252..399 740 100 Plus
chr2L 23010047 chr2L 9917856..9918022 78..244 325 79.6 Plus
chr2L 23010047 chr2L 9918300..9918628 402..730 265 72 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:06:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9920854..9921463 399..1008 3050 100 Plus
2L 23513712 2L 9920351..9920602 1..252 1260 100 Plus
2L 23513712 2L 9920654..9920801 252..399 740 100 Plus
2L 23513712 2L 9918935..9919101 78..244 325 79.6 Plus
2L 23513712 2L 9919379..9919707 402..730 265 72 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9920854..9921463 399..1008 3050 100 Plus
2L 23513712 2L 9920351..9920602 1..252 1260 100 Plus
2L 23513712 2L 9920654..9920801 252..399 740 100 Plus
2L 23513712 2L 9918935..9919021 78..164 270 87.3 Plus
2L 23513712 2L 9919544..9919707 567..730 250 76.8 Plus
Blast to na_te.dros performed on 2019-03-16 04:42:27 has no hits.

LD18769.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:43:12 Download gff for LD18769.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9919272..9919522 1..251 100 -> Plus
chr2L 9919575..9919721 252..398 100 -> Plus
chr2L 9919775..9920380 399..1004 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:53:21 Download gff for LD18769.complete
Subject Subject Range Query Range Percent Splice Strand
CG4594-RA 1..843 24..866 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:49:32 Download gff for LD18769.complete
Subject Subject Range Query Range Percent Splice Strand
CG4594-RA 1..843 24..866 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:39:40 Download gff for LD18769.complete
Subject Subject Range Query Range Percent Splice Strand
CG4594-RA 1..843 24..866 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:18:21 Download gff for LD18769.complete
Subject Subject Range Query Range Percent Splice Strand
CG4594-RA 1..843 24..866 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:48:42 Download gff for LD18769.complete
Subject Subject Range Query Range Percent Splice Strand
CG4594-RA 1..843 24..866 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:33:52 Download gff for LD18769.complete
Subject Subject Range Query Range Percent Splice Strand
CG4594-RA 1..1004 1..1004 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:49:31 Download gff for LD18769.complete
Subject Subject Range Query Range Percent Splice Strand
CG4594-RA 95..1098 1..1004 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:39:40 Download gff for LD18769.complete
Subject Subject Range Query Range Percent Splice Strand
CG4594-RA 96..1099 1..1004 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:18:21 Download gff for LD18769.complete
Subject Subject Range Query Range Percent Splice Strand
CG4594-RA 1..1004 1..1004 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:48:42 Download gff for LD18769.complete
Subject Subject Range Query Range Percent Splice Strand
CG4594-RA 96..1099 1..1004 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:43:12 Download gff for LD18769.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9920654..9920800 252..398 100 -> Plus
2L 9920351..9920601 1..251 100 -> Plus
2L 9920854..9921459 399..1004 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:43:12 Download gff for LD18769.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9920654..9920800 252..398 100 -> Plus
2L 9920351..9920601 1..251 100 -> Plus
2L 9920854..9921459 399..1004 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:43:12 Download gff for LD18769.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9920654..9920800 252..398 100 -> Plus
2L 9920351..9920601 1..251 100 -> Plus
2L 9920854..9921459 399..1004 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:39:40 Download gff for LD18769.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9920351..9920601 1..251 100 -> Plus
arm_2L 9920654..9920800 252..398 100 -> Plus
arm_2L 9920854..9921459 399..1004 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:55:15 Download gff for LD18769.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9920351..9920601 1..251 100 -> Plus
2L 9920654..9920800 252..398 100 -> Plus
2L 9920854..9921459 399..1004 100   Plus

LD18769.pep Sequence

Translation from 23 to 865

> LD18769.pep
MLRSNFLRLMAHGAPSRLMSTATKLTTVEINDKTGIATLTMNRPPVNSQN
VQLLLDLQTSISEIENNKSRGLILTSASSNVFSAGLDIFEMYNTDVERLR
TVWTELQNVWIALYGTTLPTAAAINGHAPAGGCLLATACEYRVMRPNFLI
GLNEAQLGIIAPKWLMSGFASILPKRVAERALTQGRMFTTQEAFEVGLID
EIASSKEEALEKCAAFIGTFAKVNPLARGLTKLQFRGDNIKEFEMIREKD
IADFVALASSPGVQKVMGAYLENLKNKVKK*

LD18769.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:14:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15726-PA 260 GF15726-PA 2..260 22..280 1104 79.5 Plus
Dana\GF15725-PA 281 GF15725-PA 1..280 1..280 1022 66.1 Plus
Dana\GF15727-PA 286 GF15727-PA 29..283 21..275 744 52.5 Plus
Dana\GF11465-PA 299 GF11465-PA 46..222 33..207 179 27.7 Plus
Dana\GF11161-PA 293 GF11161-PA 50..224 36..211 168 28.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10065-PA 280 GG10065-PA 1..280 1..280 1360 90.7 Plus
Dere\GG10064-PA 281 GG10064-PA 1..280 1..280 1045 67.5 Plus
Dere\GG10066-PA 287 GG10066-PA 23..286 7..277 782 53.1 Plus
Dere\GG22562-PA 299 GG22562-PA 46..222 33..207 182 28.8 Plus
Dere\GG22466-PA 294 GG22466-PA 51..216 36..202 163 28.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11302-PA 281 GH11302-PA 1..280 1..279 987 65.7 Plus
Dgri\GH11303-PA 282 GH11303-PA 22..282 20..280 645 49 Plus
Dgri\GH22640-PA 298 GH22640-PA 45..221 33..207 173 27.7 Plus
Dgri\GH20865-PA 293 GH20865-PA 46..215 32..202 171 29.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG4594-PB 280 CG4594-PB 1..280 1..280 1406 100 Plus
CG4594-PA 280 CG4594-PA 1..280 1..280 1406 100 Plus
CG4598-PB 281 CG4598-PB 1..280 1..280 1001 67.1 Plus
CG4598-PA 281 CG4598-PA 1..280 1..280 1001 67.1 Plus
CG4592-PB 287 CG4592-PB 23..286 7..277 755 54.6 Plus
CG4592-PA 287 CG4592-PA 23..286 7..277 755 54.6 Plus
CG8778-PA 299 CG8778-PA 46..222 33..207 181 27.7 Plus
Echs1-PA 295 CG6543-PA 52..222 36..207 167 27.2 Plus
Echs1-PB 295 CG6543-PB 52..222 36..207 167 27.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17722-PA 281 GI17722-PA 1..280 1..279 913 65.4 Plus
Dmoj\GI17724-PA 262 GI17724-PA 1..259 19..277 910 63.7 Plus
Dmoj\GI17723-PA 286 GI17723-PA 29..285 23..279 700 52.1 Plus
Dmoj\GI21154-PA 301 GI21154-PA 48..224 33..207 176 27.7 Plus
Dmoj\GI20973-PA 293 GI20973-PA 46..220 32..207 164 27.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18943-PA 280 GL18943-PA 1..280 1..280 1041 67.5 Plus
Dper\GL18944-PA 214 GL18944-PA 1..213 19..280 787 59.2 Plus
Dper\GL18945-PA 286 GL18945-PA 16..285 1..277 775 53.1 Plus
Dper\GL16995-PA 296 GL16995-PA 75..241 57..223 149 28.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25865-PA 280 GA25865-PA 1..279 2..280 1056 69.9 Plus
Dpse\GA18288-PA 280 GA18288-PA 1..280 1..280 1037 67.5 Plus
Dpse\GA25867-PA 286 GA25867-PA 16..285 1..277 775 53.1 Plus
Dpse\GA21314-PA 298 GA21314-PA 45..222 33..208 183 28.7 Plus
Dpse\GA19673-PB 296 GA19673-PB 49..241 32..223 180 28.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17776-PA 280 GM17776-PA 1..280 1..280 1389 92.9 Plus
Dsec\GM17765-PA 281 GM17765-PA 1..280 1..280 1030 66.4 Plus
Dsec\GM17787-PA 287 GM17787-PA 23..286 7..277 801 55 Plus
Dsec\GM20345-PA 233 GM20345-PA 14..156 65..207 166 30.1 Plus
Dsec\GM20252-PA 294 GM20252-PA 51..216 36..202 164 28.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23638-PA 280 GD23638-PA 1..280 1..280 1406 94.3 Plus
Dsim\GD23637-PA 281 GD23637-PA 1..280 1..280 1030 66.4 Plus
Dsim\GD23639-PA 287 GD23639-PA 23..286 7..277 797 54.6 Plus
Dsim\GD25824-PA 299 GD25824-PA 46..222 33..207 181 28.8 Plus
Dsim\GD25738-PA 294 GD25738-PA 51..216 36..202 164 28.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:14:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17550-PA 281 GJ17550-PA 1..280 1..279 941 64.6 Plus
Dvir\GJ17551-PA 284 GJ17551-PA 1..284 1..280 745 51.6 Plus
Dvir\GJ21004-PA 281 GJ21004-PA 28..204 33..207 179 29.4 Plus
Dvir\GJ20693-PA 293 GJ20693-PA 27..215 16..202 166 27.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:14:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18281-PA 279 GK18281-PA 1..278 1..279 1021 67.4 Plus
Dwil\GK24255-PA 290 GK24255-PA 1..284 1..279 836 56.3 Plus
Dwil\GK24256-PA 287 GK24256-PA 1..273 1..271 800 54.9 Plus
Dwil\GK15915-PA 302 GK15915-PA 49..225 33..207 175 28.2 Plus
Dwil\GK17937-PA 295 GK17937-PA 48..238 32..221 170 28.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18879-PA 280 GE18879-PA 1..280 1..280 1368 91.1 Plus
Dyak\GE18878-PA 281 GE18878-PA 1..280 1..280 1056 67.9 Plus
Dyak\GE18880-PA 287 GE18880-PA 23..286 7..277 793 53.9 Plus
Dyak\GE13432-PA 299 GE13432-PA 46..222 33..207 182 28.8 Plus
Dyak\GE13337-PA 294 GE13337-PA 27..216 16..202 173 28.1 Plus

LD18769.hyp Sequence

Translation from 23 to 865

> LD18769.hyp
MLRSNFLRLMAHGAPSRLMSTATKLTTVEINDKTGIATLTMNRPPVNSQN
VQLLLDLQTSISEIENNKSRGLILTSASSNVFSAGLDIFEMYNTDVERLR
TVWTELQNVWIALYGTTLPTAAAINGHAPAGGCLLATACEYRVMRPNFLI
GLNEAQLGIIAPKWLMSGFASILPKRVAERALTQGRMFTTQEAFEVGLID
EIASSKEEALEKCAAFIGTFAKVNPLARGLTKLQFRGDNIKEFEMIREKD
IADFVALASSPGVQKVMGAYLENLKNKVKK*

LD18769.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:08:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG4594-PB 280 CG4594-PB 1..280 1..280 1406 100 Plus
CG4594-PA 280 CG4594-PA 1..280 1..280 1406 100 Plus
CG4598-PB 281 CG4598-PB 1..280 1..280 1001 67.1 Plus
CG4598-PA 281 CG4598-PA 1..280 1..280 1001 67.1 Plus
CG4592-PB 287 CG4592-PB 23..286 7..277 755 54.6 Plus