Clone LD19034 Report

Search the DGRC for LD19034

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:190
Well:34
Vector:pBS SK-
Associated Gene/Transcriptendos-RB
Protein status:LD19034.pep: gold
Preliminary Size:1335
Sequenced Size:1098

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6513 2001-01-01 Release 2 assignment
CG6513 2002-05-31 Blastp of sequenced clone
CG6513 2003-01-01 Sim4 clustering to Release 3
endos 2008-04-29 Release 5.5 accounting
endos 2008-08-15 Release 5.9 accounting
endos 2008-12-18 5.12 accounting

Clone Sequence Records

LD19034.complete Sequence

1098 bp (1098 high quality bases) assembled on 2002-05-31

GenBank Submission: AY118326

> LD19034.complete
AGACAGTCTTGCGTCTGTAAAGTGATAAAATAATTTTACAATTGAGTCGC
CTTGGGAATTTCAGTCACTCTCCACACACCAAATACATAGCTCGTGTAAC
AGCCTGATTTAGTCGAACAGCACATCATTTGCCGGAATCGTTAGCGAATA
GCAGCACTCTCCGCTAAGTCGGCACGCTAATTGGCAAAACCGATTCGATT
CCAGGGAAGGAGACACACTGATAGACGGGTGAAGAACAAAAGGAGAAGGA
AAACAACAGTTAATCGTCAAATTTTACAGGCAAAAGGCAGCACACAATGA
GCTCCGCGGAAGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGACACC
GAGACCACCGAGCAGGCTAACCTCACGGATCTCGAGAAGATCGAGGAGGA
GAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGACACT
CGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGACTCG
GGCGATTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGGTCTT
TGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACCGTGC
CGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGCGACG
AGCTAATTTACTCACCACTCAACACTCACCTCTACTGTATCCACAACCTC
AAGTGCAGCCAGTTCTCCGTTCCCCACTTCAAATGCTCTATACCTAATTT
TAATGAAAAACCTAATGCTAAGATGGCTGCTGCCGGATTGTGCGGGCATT
TCGCGACAGTTTAAACTGAAATTCTAGCACCATGTTCCGTGTTTCCCCCG
TTAAATTCAATCGCCATCCGCACTGGCCAATCAATCTCAAGATCAACTCA
TCAGTCCATCTCTCAGGCCGGGGAAGCGAAGATGGCGAGCCGAGCAGCGC
GAAATTTATTGCAACAGTTATATATATCTCTATCTTTGTAACATTAAACT
AACTTACCCTCGTCGTACATAGTTGTAAGTATTACGAGCATAATAAATTT
AAGTTGGAGCAGCCAGCCACACACACACAAAAAAAAAAAAAAAAAAAA

LD19034.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
endos-RA 1453 endos-RA 77..1155 1..1079 5395 100 Plus
endos.a 1409 endos.a 370..1164 285..1079 3975 100 Plus
endos-RB 1343 endos-RB 305..1098 286..1079 3970 100 Plus
endos.a 1409 endos.a 31..316 1..286 1430 100 Plus
endos-RB 1343 endos-RB 1..225 63..287 1125 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:29:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14019920..14020516 1078..482 2970 99.8 Minus
chr3L 24539361 chr3L 14021486..14021772 287..1 1375 98.6 Minus
chr3L 24539361 chr3L 14020904..14021101 482..285 975 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:06:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:29:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14029824..14030421 1079..482 2990 100 Minus
3L 28110227 3L 14031388..14031674 287..1 1435 100 Minus
3L 28110227 3L 14030807..14031004 482..285 990 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:28:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14022924..14023521 1079..482 2990 100 Minus
3L 28103327 3L 14024488..14024774 287..1 1435 100 Minus
3L 28103327 3L 14023907..14024104 482..285 990 100 Minus
Blast to na_te.dros performed on 2019-03-15 11:29:43 has no hits.

LD19034.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:30:23 Download gff for LD19034.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14019920..14020515 483..1078 99 <- Minus
chr3L 14020904..14021099 287..482 99 <- Minus
chr3L 14021487..14021772 1..286 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:53:34 Download gff for LD19034.complete
Subject Subject Range Query Range Percent Splice Strand
endos-RB 1..360 297..656 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:34:21 Download gff for LD19034.complete
Subject Subject Range Query Range Percent Splice Strand
endos-RC 1..360 297..656 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:30:05 Download gff for LD19034.complete
Subject Subject Range Query Range Percent Splice Strand
endos-RD 1..360 297..656 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:25:57 Download gff for LD19034.complete
Subject Subject Range Query Range Percent Splice Strand
endos-RB 1..360 297..656 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:36:36 Download gff for LD19034.complete
Subject Subject Range Query Range Percent Splice Strand
endos-RD 1..360 297..656 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:05:32 Download gff for LD19034.complete
Subject Subject Range Query Range Percent Splice Strand
endos-RA 31..1108 1..1078 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:34:21 Download gff for LD19034.complete
Subject Subject Range Query Range Percent Splice Strand
endos-RA 31..1108 1..1078 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:30:05 Download gff for LD19034.complete
Subject Subject Range Query Range Percent Splice Strand
endos-RA 33..1110 1..1078 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:25:57 Download gff for LD19034.complete
Subject Subject Range Query Range Percent Splice Strand
endos-RA 31..1108 1..1078 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:36:36 Download gff for LD19034.complete
Subject Subject Range Query Range Percent Splice Strand
endos-RA 33..1110 1..1078 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:30:23 Download gff for LD19034.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14031389..14031674 1..286 100   Minus
3L 14029825..14030420 483..1078 100 <- Minus
3L 14030807..14031002 287..482 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:30:23 Download gff for LD19034.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14031389..14031674 1..286 100   Minus
3L 14029825..14030420 483..1078 100 <- Minus
3L 14030807..14031002 287..482 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:30:23 Download gff for LD19034.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14031389..14031674 1..286 100   Minus
3L 14029825..14030420 483..1078 100 <- Minus
3L 14030807..14031002 287..482 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:30:05 Download gff for LD19034.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14024489..14024774 1..286 100   Minus
arm_3L 14022925..14023520 483..1078 100 <- Minus
arm_3L 14023907..14024102 287..482 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:58:22 Download gff for LD19034.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14022925..14023520 483..1078 100 <- Minus
3L 14023907..14024102 287..482 100 <- Minus
3L 14024489..14024774 1..286 100   Minus

LD19034.hyp Sequence

Translation from 296 to 655

> LD19034.hyp
MSSAEENSNSPATTPQDTETTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS*

LD19034.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:35:55
Subject Length Description Subject Range Query Range Score Percent Strand
endos-PF 119 CG6513-PF 1..119 1..119 614 100 Plus
endos-PE 119 CG6513-PE 1..119 1..119 614 100 Plus
endos-PD 119 CG6513-PD 1..119 1..119 614 100 Plus
endos-PC 119 CG6513-PC 1..119 1..119 614 100 Plus
endos-PB 119 CG6513-PB 1..119 1..119 614 100 Plus

LD19034.pep Sequence

Translation from 296 to 655

> LD19034.pep
MSSAEENSNSPATTPQDTETTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS*

LD19034.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:37:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24489-PA 119 GF24489-PA 1..119 1..119 608 97.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13739-PA 118 GG13739-PA 1..118 1..119 594 96.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15121-PA 119 GH15121-PA 1..119 1..119 517 86.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
endos-PF 119 CG6513-PF 1..119 1..119 614 100 Plus
endos-PE 119 CG6513-PE 1..119 1..119 614 100 Plus
endos-PD 119 CG6513-PD 1..119 1..119 614 100 Plus
endos-PC 119 CG6513-PC 1..119 1..119 614 100 Plus
endos-PB 119 CG6513-PB 1..119 1..119 614 100 Plus
endos-PA 119 CG6513-PA 1..119 1..119 614 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:37:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13773-PA 118 GI13773-PA 1..118 1..119 535 90 Plus
Dmoj\GI16393-PA 96 GI16393-PA 11..92 29..113 212 58.1 Plus
Dmoj\GI10097-PA 118 GI10097-PA 11..102 19..111 186 47.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:37:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25060-PA 120 GL25060-PA 1..120 1..119 541 89.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19653-PA 120 GA19653-PA 1..120 1..119 541 89.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24562-PA 119 GM24562-PA 1..119 1..119 612 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12636-PA 119 GD12636-PA 1..119 1..119 612 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13577-PA 118 GJ13577-PA 1..118 1..119 544 90 Plus
Dvir\GJ23833-PA 126 GJ23833-PA 6..102 7..106 302 61 Plus
Dvir\GJ17011-PA 116 GJ17011-PA 1..109 1..111 283 60.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17252-PA 121 GK17252-PA 1..121 1..119 554 90.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20034-PA 119 GE20034-PA 1..119 1..119 603 96.6 Plus