Clone LD19311 Report

Search the DGRC for LD19311

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:193
Well:11
Vector:pBS SK-
Associated Gene/TranscriptCG7970-RA
Protein status:LD19311.pep: gold
Preliminary Size:1078
Sequenced Size:890

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7970 2001-01-01 Release 2 assignment
CG7970 2001-10-10 Blastp of sequenced clone
CG7970 2003-01-01 Sim4 clustering to Release 3
CG7970 2008-04-29 Release 5.5 accounting
CG7970 2008-08-15 Release 5.9 accounting
CG7970 2008-12-18 5.12 accounting

Clone Sequence Records

LD19311.complete Sequence

890 bp (890 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061264

> LD19311.complete
AAACGTTTGGAGTTTCTCAGGCACATCTCTGCACCACCGGCAACATGGTT
CTCTCCAAGCCCCTGTACTCGCTCTTCGGCACTTATCTGGAGCAGCTCTT
CAACCACCCGGTCCGCACCAAATCCATTACGGCATGCGTTCTGGCCACCT
CGGCTAATGTCACCTCCCAGCGTTTGGCGGGCGCCAAGACCCTCAACCAG
CAGAGCGTATTCGCCTACGGACTCTTTGGACTGATCTTCGGCGGTAGTGT
GCCGCACTACTTCTACACGACGGTGGAGCGACTCTTCAGCCAGGATGTGC
GCTTCCGAAGATTCTTCCTGTTCCTGTCCGAGCGACTGGTCTATGCTCCG
ATTTACCAGGCACTGTCCCTGTTCTTCTTGGCCCTGTTCGAGGGCAAGTC
TCCCAGCACTGCATTGAAGAATGTTGAGAAGCTCTACTGGCCTCTGCTGA
AGGCCAACTGGCAGTACCTGTCCGTGTTCGTGTACCTCAACTTCGCCTAC
GTGCCCCCGATGTTCCGGTCCATCAGCATGGCCATCATCTCCTTCATCTG
GGTGGTGTACATCGCCCAGAAGCGTCGCCGCTTCCAGGACAAGCTGGCCG
CCAAAGAGGCAGCCAAATAGGCTATACGACCCTTAAACCCTGTGGTAGTC
GTCTTGGCCTAATATTCCAATTACTGCTTAGATTACGGCTGAACTGCTTC
AAGTTCTTTATCTTCCCGCGTTCCGGCGGATTGCAAAAAGTCCGTGTGTA
TTTGAACACTTTAGATAAGCTAAAACTAACTGGAGGGGCGCCTTATCAAC
CGACTGTTGTTATACCTTAAACCCTAAATTTTGTAAACTTTTCTTACCAA
AATAAACTAATATACAATGTAAAAAAAAAAAAAAAAAAAA

LD19311.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG7970-RA 1024 CG7970-RA 57..927 1..871 4355 100 Plus
CG7970.a 930 CG7970.a 78..930 18..870 4265 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1653228..1653707 391..870 2310 98.8 Plus
chr3L 24539361 chr3L 1652912..1653171 134..393 1300 100 Plus
chr3L 24539361 chr3L 1652734..1652849 18..133 580 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:06:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:52:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1653633..1654113 391..871 2405 100 Plus
3L 28110227 3L 1653317..1653576 134..393 1300 100 Plus
3L 28110227 3L 1653139..1653254 18..133 580 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1653633..1654113 391..871 2405 100 Plus
3L 28103327 3L 1653317..1653576 134..393 1300 100 Plus
3L 28103327 3L 1653139..1653254 18..133 580 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:52:45 has no hits.

LD19311.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:54:28 Download gff for LD19311.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1652619..1652638 1..20 100 -> Plus
chr3L 1652737..1652849 21..133 100 -> Plus
chr3L 1652912..1653170 134..392 100 -> Plus
chr3L 1653230..1653707 393..870 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:53:54 Download gff for LD19311.complete
Subject Subject Range Query Range Percent Splice Strand
CG7970-RA 1..576 45..620 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:40:33 Download gff for LD19311.complete
Subject Subject Range Query Range Percent Splice Strand
CG7970-RA 1..576 45..620 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:44:45 Download gff for LD19311.complete
Subject Subject Range Query Range Percent Splice Strand
CG7970-RA 1..576 45..620 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:18:39 Download gff for LD19311.complete
Subject Subject Range Query Range Percent Splice Strand
CG7970-RA 1..576 45..620 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:19:53 Download gff for LD19311.complete
Subject Subject Range Query Range Percent Splice Strand
CG7970-RC 149..768 1..620 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:46:05 Download gff for LD19311.complete
Subject Subject Range Query Range Percent Splice Strand
CG7970-RA 20..887 1..868 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:40:33 Download gff for LD19311.complete
Subject Subject Range Query Range Percent Splice Strand
CG7970-RA 20..889 1..870 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:44:45 Download gff for LD19311.complete
Subject Subject Range Query Range Percent Splice Strand
CG7970-RA 20..889 1..870 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:18:39 Download gff for LD19311.complete
Subject Subject Range Query Range Percent Splice Strand
CG7970-RA 20..887 1..868 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:19:53 Download gff for LD19311.complete
Subject Subject Range Query Range Percent Splice Strand
CG7970-RA 20..889 1..870 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:54:28 Download gff for LD19311.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1653024..1653043 1..20 100 -> Plus
3L 1653142..1653254 21..133 100 -> Plus
3L 1653317..1653575 134..392 100 -> Plus
3L 1653635..1654112 393..870 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:54:28 Download gff for LD19311.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1653024..1653043 1..20 100 -> Plus
3L 1653142..1653254 21..133 100 -> Plus
3L 1653317..1653575 134..392 100 -> Plus
3L 1653635..1654112 393..870 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:54:28 Download gff for LD19311.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1653024..1653043 1..20 100 -> Plus
3L 1653142..1653254 21..133 100 -> Plus
3L 1653317..1653575 134..392 100 -> Plus
3L 1653635..1654112 393..870 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:44:45 Download gff for LD19311.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1653024..1653043 1..20 100 -> Plus
arm_3L 1653142..1653254 21..133 100 -> Plus
arm_3L 1653317..1653575 134..392 100 -> Plus
arm_3L 1653635..1654112 393..870 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:53:37 Download gff for LD19311.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1653317..1653575 134..392 100 -> Plus
3L 1653635..1654112 393..870 100   Plus
3L 1653024..1653043 1..20 100 -> Plus
3L 1653142..1653254 21..133 100 -> Plus

LD19311.hyp Sequence

Translation from 2 to 619

> LD19311.hyp
TFGVSQAHLCTTGNMVLSKPLYSLFGTYLEQLFNHPVRTKSITACVLATS
ANVTSQRLAGAKTLNQQSVFAYGLFGLIFGGSVPHYFYTTVERLFSQDVR
FRRFFLFLSERLVYAPIYQALSLFFLALFEGKSPSTALKNVEKLYWPLLK
ANWQYLSVFVYLNFAYVPPMFRSISMAIISFIWVVYIAQKRRRFQDKLAA
KEAAK*

LD19311.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:05:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG7970-PC 255 CG7970-PC 51..255 1..205 1052 100 Plus
CG7970-PB 191 CG7970-PB 1..191 15..205 975 100 Plus
CG7970-PA 191 CG7970-PA 1..191 15..205 975 100 Plus

LD19311.pep Sequence

Translation from 44 to 619

> LD19311.pep
MVLSKPLYSLFGTYLEQLFNHPVRTKSITACVLATSANVTSQRLAGAKTL
NQQSVFAYGLFGLIFGGSVPHYFYTTVERLFSQDVRFRRFFLFLSERLVY
APIYQALSLFFLALFEGKSPSTALKNVEKLYWPLLKANWQYLSVFVYLNF
AYVPPMFRSISMAIISFIWVVYIAQKRRRFQDKLAAKEAAK*

LD19311.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24823-PA 191 GF24823-PA 1..191 1..191 884 93.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14812-PA 191 GG14812-PA 1..191 1..191 955 95.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15958-PA 193 GH15958-PA 1..191 1..191 753 74.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG7970-PB 191 CG7970-PB 1..191 1..191 975 100 Plus
CG7970-PA 191 CG7970-PA 1..191 1..191 975 100 Plus
CG7970-PC 255 CG7970-PC 65..255 1..191 975 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16611-PA 190 GI16611-PA 1..189 1..189 828 81 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:13:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11923-PA 190 GL11923-PA 1..189 1..189 856 85.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:13:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20730-PA 190 GA20730-PA 1..189 1..189 856 85.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:13:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14435-PA 191 GM14435-PA 1..191 1..191 978 97.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:13:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13636-PA 191 GD13636-PA 1..191 1..191 978 97.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:13:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12865-PA 190 GJ12865-PA 1..190 1..190 815 77.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:13:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24419-PA 190 GK24419-PA 1..189 1..189 859 85.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:13:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21175-PA 191 GE21175-PA 1..182 1..182 924 97.3 Plus