BDGP Sequence Production Resources |
Search the DGRC for LD19311
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 193 |
Well: | 11 |
Vector: | pBS SK- |
Associated Gene/Transcript | CG7970-RA |
Protein status: | LD19311.pep: gold |
Preliminary Size: | 1078 |
Sequenced Size: | 890 |
Gene | Date | Evidence |
---|---|---|
CG7970 | 2001-01-01 | Release 2 assignment |
CG7970 | 2001-10-10 | Blastp of sequenced clone |
CG7970 | 2003-01-01 | Sim4 clustering to Release 3 |
CG7970 | 2008-04-29 | Release 5.5 accounting |
CG7970 | 2008-08-15 | Release 5.9 accounting |
CG7970 | 2008-12-18 | 5.12 accounting |
890 bp (890 high quality bases) assembled on 2001-10-10
GenBank Submission: AY061264
> LD19311.complete AAACGTTTGGAGTTTCTCAGGCACATCTCTGCACCACCGGCAACATGGTT CTCTCCAAGCCCCTGTACTCGCTCTTCGGCACTTATCTGGAGCAGCTCTT CAACCACCCGGTCCGCACCAAATCCATTACGGCATGCGTTCTGGCCACCT CGGCTAATGTCACCTCCCAGCGTTTGGCGGGCGCCAAGACCCTCAACCAG CAGAGCGTATTCGCCTACGGACTCTTTGGACTGATCTTCGGCGGTAGTGT GCCGCACTACTTCTACACGACGGTGGAGCGACTCTTCAGCCAGGATGTGC GCTTCCGAAGATTCTTCCTGTTCCTGTCCGAGCGACTGGTCTATGCTCCG ATTTACCAGGCACTGTCCCTGTTCTTCTTGGCCCTGTTCGAGGGCAAGTC TCCCAGCACTGCATTGAAGAATGTTGAGAAGCTCTACTGGCCTCTGCTGA AGGCCAACTGGCAGTACCTGTCCGTGTTCGTGTACCTCAACTTCGCCTAC GTGCCCCCGATGTTCCGGTCCATCAGCATGGCCATCATCTCCTTCATCTG GGTGGTGTACATCGCCCAGAAGCGTCGCCGCTTCCAGGACAAGCTGGCCG CCAAAGAGGCAGCCAAATAGGCTATACGACCCTTAAACCCTGTGGTAGTC GTCTTGGCCTAATATTCCAATTACTGCTTAGATTACGGCTGAACTGCTTC AAGTTCTTTATCTTCCCGCGTTCCGGCGGATTGCAAAAAGTCCGTGTGTA TTTGAACACTTTAGATAAGCTAAAACTAACTGGAGGGGCGCCTTATCAAC CGACTGTTGTTATACCTTAAACCCTAAATTTTGTAAACTTTTCTTACCAA AATAAACTAATATACAATGTAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 1653228..1653707 | 391..870 | 2310 | 98.8 | Plus |
chr3L | 24539361 | chr3L | 1652912..1653171 | 134..393 | 1300 | 100 | Plus |
chr3L | 24539361 | chr3L | 1652734..1652849 | 18..133 | 580 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 1652619..1652638 | 1..20 | 100 | -> | Plus |
chr3L | 1652737..1652849 | 21..133 | 100 | -> | Plus |
chr3L | 1652912..1653170 | 134..392 | 100 | -> | Plus |
chr3L | 1653230..1653707 | 393..870 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7970-RA | 1..576 | 45..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7970-RA | 1..576 | 45..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7970-RA | 1..576 | 45..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7970-RA | 1..576 | 45..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7970-RC | 149..768 | 1..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7970-RA | 20..887 | 1..868 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7970-RA | 20..889 | 1..870 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7970-RA | 20..889 | 1..870 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7970-RA | 20..887 | 1..868 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7970-RA | 20..889 | 1..870 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1653024..1653043 | 1..20 | 100 | -> | Plus |
3L | 1653142..1653254 | 21..133 | 100 | -> | Plus |
3L | 1653317..1653575 | 134..392 | 100 | -> | Plus |
3L | 1653635..1654112 | 393..870 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1653024..1653043 | 1..20 | 100 | -> | Plus |
3L | 1653142..1653254 | 21..133 | 100 | -> | Plus |
3L | 1653317..1653575 | 134..392 | 100 | -> | Plus |
3L | 1653635..1654112 | 393..870 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1653024..1653043 | 1..20 | 100 | -> | Plus |
3L | 1653142..1653254 | 21..133 | 100 | -> | Plus |
3L | 1653317..1653575 | 134..392 | 100 | -> | Plus |
3L | 1653635..1654112 | 393..870 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 1653024..1653043 | 1..20 | 100 | -> | Plus |
arm_3L | 1653142..1653254 | 21..133 | 100 | -> | Plus |
arm_3L | 1653317..1653575 | 134..392 | 100 | -> | Plus |
arm_3L | 1653635..1654112 | 393..870 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1653317..1653575 | 134..392 | 100 | -> | Plus |
3L | 1653635..1654112 | 393..870 | 100 | Plus | |
3L | 1653024..1653043 | 1..20 | 100 | -> | Plus |
3L | 1653142..1653254 | 21..133 | 100 | -> | Plus |
Translation from 2 to 619
> LD19311.hyp TFGVSQAHLCTTGNMVLSKPLYSLFGTYLEQLFNHPVRTKSITACVLATS ANVTSQRLAGAKTLNQQSVFAYGLFGLIFGGSVPHYFYTTVERLFSQDVR FRRFFLFLSERLVYAPIYQALSLFFLALFEGKSPSTALKNVEKLYWPLLK ANWQYLSVFVYLNFAYVPPMFRSISMAIISFIWVVYIAQKRRRFQDKLAA KEAAK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7970-PC | 255 | CG7970-PC | 51..255 | 1..205 | 1052 | 100 | Plus |
CG7970-PB | 191 | CG7970-PB | 1..191 | 15..205 | 975 | 100 | Plus |
CG7970-PA | 191 | CG7970-PA | 1..191 | 15..205 | 975 | 100 | Plus |
Translation from 44 to 619
> LD19311.pep MVLSKPLYSLFGTYLEQLFNHPVRTKSITACVLATSANVTSQRLAGAKTL NQQSVFAYGLFGLIFGGSVPHYFYTTVERLFSQDVRFRRFFLFLSERLVY APIYQALSLFFLALFEGKSPSTALKNVEKLYWPLLKANWQYLSVFVYLNF AYVPPMFRSISMAIISFIWVVYIAQKRRRFQDKLAAKEAAK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24823-PA | 191 | GF24823-PA | 1..191 | 1..191 | 884 | 93.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14812-PA | 191 | GG14812-PA | 1..191 | 1..191 | 955 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15958-PA | 193 | GH15958-PA | 1..191 | 1..191 | 753 | 74.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7970-PB | 191 | CG7970-PB | 1..191 | 1..191 | 975 | 100 | Plus |
CG7970-PA | 191 | CG7970-PA | 1..191 | 1..191 | 975 | 100 | Plus |
CG7970-PC | 255 | CG7970-PC | 65..255 | 1..191 | 975 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16611-PA | 190 | GI16611-PA | 1..189 | 1..189 | 828 | 81 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11923-PA | 190 | GL11923-PA | 1..189 | 1..189 | 856 | 85.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20730-PA | 190 | GA20730-PA | 1..189 | 1..189 | 856 | 85.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14435-PA | 191 | GM14435-PA | 1..191 | 1..191 | 978 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13636-PA | 191 | GD13636-PA | 1..191 | 1..191 | 978 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12865-PA | 190 | GJ12865-PA | 1..190 | 1..190 | 815 | 77.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24419-PA | 190 | GK24419-PA | 1..189 | 1..189 | 859 | 85.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21175-PA | 191 | GE21175-PA | 1..182 | 1..182 | 924 | 97.3 | Plus |