Clone LD19356 Report

Search the DGRC for LD19356

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:193
Well:56
Vector:pBS SK-
Associated Gene/Transcriptelm-RA
Protein status:LD19356.pep: gold
Preliminary Size:1259
Sequenced Size:1140

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2185 2001-01-01 Release 2 assignment
CG2185 2003-01-01 Sim4 clustering to Release 3
CG2185 2003-01-13 Blastp of sequenced clone
CG2185 2008-04-29 Release 5.5 accounting
CG2185 2008-08-15 Release 5.9 accounting
CG2185 2008-12-18 5.12 accounting

Clone Sequence Records

LD19356.complete Sequence

1140 bp (1140 high quality bases) assembled on 2003-01-13

GenBank Submission: AY069465

> LD19356.complete
CCCGTCACTCCGCCTGCATTCAGCCTGTACACAAATCGGACTTGTGGTCC
AATCCAAATCGAATGCCATTCAATGCTCGTCTGCGATTGTTGAATGTTTA
AACAAACCGATCGGCGCACAACACACCGTCACCATGGGCAATAAGTCGTC
GCTTTTCCTGCGGAACGAGGAGATCGCGCAAATCCAGGAGGAGACTGGCT
TCACCCCCAACCAAATCGAGCGACTTTACTCGCGCTTCACCTCCTTGGAT
CGCAATGATTGCGGAACCTTGTCCCGGGAGGATCTGATGCGTATCCCGGA
ACTGGCCATTAATCCGCTGTGCGAGCGGATAGTTCATTCCTTTTTCGCTG
AGAGCAACGACGATCGGGTGAACTTCCGGCAGTTCATGAACGTCCTGGCC
CACTTCCGGCCGCTGAGGGATAACAAGCAAAGTAAGCTCAACAGCCGGGA
GGAGAAGCTGAAGTTCGCCTTCAAGATGTACGATCTGGATGACGATGGTG
TGATCAGCAGAGACGAGCTGCTCTCCATCCTGCACATGATGGTCGGGGCG
AACATTAGCCAGGACCAGTTGGTCAGCATTGCGGAGAGGACGATCCTGGA
GGCGGACCTGTGCTGCCAGGGCAAGATCTCGTTCGAGGACTTCTGCAAAG
CTCTGGACCGCACCGACGTGGATCAGAAGATGTCCATACGGTTTCTCAAC
TAGGCTAGCTGGATGCGGCAATCACGAGGAAAGAGCGACCTTCTTAGTCA
GTGTGTACCAAATAGTTTAGGATGCAGTTAGTCGAGAGGCATTCCGGCGG
GTTACTGAAAACTCTAATGATTTGAAAGCAGTGGTTGCTATTCTTATTAT
ACCAGTTGTGTTTTCCAACCATTTAGAAGTTTCAATTTAATGAATGAAAA
TGAAAGTGTCGCAAAGTTTTTTAAACCTGAGTAATTTGCCCAAAGCTTAT
CGAAGATATTTCATTCAAGTTAAACAAAAAATGCATATGTTTGATCACGG
GTGCTAGAGAAATACAGAAAAATATAACCAATTGCTTGGTATCTAAAAGT
TAAATGCGTCCGGAAATTTGATCAAATATTTATGATAAAAATATAAATAA
ATCTTTTGCTGTCTTATATTACAAAAAAAAAAAAAAAAAA

LD19356.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:27:36
Subject Length Description Subject Range Query Range Score Percent Strand
elm.c 1368 elm.c 53..1181 1..1129 5645 100 Plus
elm-RA 1457 elm-RA 142..1270 1..1129 5645 100 Plus
elm.b 1064 elm.b 142..895 1..754 3770 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:40:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1478491..1479412 1122..201 4610 100 Minus
chr3R 27901430 chr3R 1480314..1480513 200..1 1000 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:06:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5652826..5653754 1129..201 4645 100 Minus
3R 32079331 3R 5654656..5654855 200..1 1000 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5393657..5394585 1129..201 4645 100 Minus
3R 31820162 3R 5395487..5395686 200..1 1000 100 Minus
Blast to na_te.dros performed on 2019-03-16 10:40:40 has no hits.

LD19356.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:41:28 Download gff for LD19356.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1478491..1479412 201..1122 96 <- Minus
chr3R 1480314..1480513 1..200 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:53:56 Download gff for LD19356.complete
Subject Subject Range Query Range Percent Splice Strand
CG2185-RA 1..570 134..703 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:58:20 Download gff for LD19356.complete
Subject Subject Range Query Range Percent Splice Strand
elm-RA 1..570 134..703 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:03:05 Download gff for LD19356.complete
Subject Subject Range Query Range Percent Splice Strand
elm-RA 1..570 134..703 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:49:06 Download gff for LD19356.complete
Subject Subject Range Query Range Percent Splice Strand
CG2185-RA 1..570 134..703 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:14:37 Download gff for LD19356.complete
Subject Subject Range Query Range Percent Splice Strand
elm-RA 1..570 134..703 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:14:50 Download gff for LD19356.complete
Subject Subject Range Query Range Percent Splice Strand
CG2185-RA 37..1158 1..1122 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:58:19 Download gff for LD19356.complete
Subject Subject Range Query Range Percent Splice Strand
elm-RA 37..1158 1..1122 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:03:05 Download gff for LD19356.complete
Subject Subject Range Query Range Percent Splice Strand
elm-RA 7..1128 1..1122 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:49:07 Download gff for LD19356.complete
Subject Subject Range Query Range Percent Splice Strand
CG2185-RA 37..1158 1..1122 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:14:37 Download gff for LD19356.complete
Subject Subject Range Query Range Percent Splice Strand
elm-RA 7..1128 1..1122 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:41:28 Download gff for LD19356.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5652833..5653754 201..1122 100 <- Minus
3R 5654656..5654855 1..200 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:41:28 Download gff for LD19356.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5652833..5653754 201..1122 100 <- Minus
3R 5654656..5654855 1..200 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:41:28 Download gff for LD19356.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5652833..5653754 201..1122 100 <- Minus
3R 5654656..5654855 1..200 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:03:05 Download gff for LD19356.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1478555..1479476 201..1122 100 <- Minus
arm_3R 1480378..1480577 1..200 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:20:34 Download gff for LD19356.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5393664..5394585 201..1122 100 <- Minus
3R 5395487..5395686 1..200 100   Minus

LD19356.hyp Sequence

Translation from 0 to 702

> LD19356.hyp
PSLRLHSACTQIGLVVQSKSNAIQCSSAIVECLNKPIGAQHTVTMGNKSS
LFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPE
LAINPLCERIVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSRE
EKLKFAFKMYDLDDDGVISRDELLSILHMMVGANISQDQLVSIAERTILE
ADLCCQGKISFEDFCKALDRTDVDQKMSIRFLN*

LD19356.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:31:46
Subject Length Description Subject Range Query Range Score Percent Strand
elm-PB 189 CG2185-PB 1..189 45..233 969 100 Plus
elm-PA 189 CG2185-PA 1..189 45..233 969 100 Plus
CanB-PB 170 CG4209-PB 1..168 45..229 311 38.9 Plus
CanB-PA 170 CG4209-PA 1..168 45..229 311 38.9 Plus
CanB2-PB 170 CG11217-PB 1..168 45..229 308 38.9 Plus

LD19356.pep Sequence

Translation from 133 to 702

> LD19356.pep
MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSRED
LMRIPELAINPLCERIVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQS
KLNSREEKLKFAFKMYDLDDDGVISRDELLSILHMMVGANISQDQLVSIA
ERTILEADLCCQGKISFEDFCKALDRTDVDQKMSIRFLN*

LD19356.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:12:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17404-PA 189 GF17404-PA 1..189 1..189 991 100 Plus
Dana\GF13200-PA 170 GF13200-PA 1..168 1..185 309 38.9 Plus
Dana\GF19757-PA 170 GF19757-PA 1..168 1..185 308 38.9 Plus
Dana\GF20437-PA 179 GF20437-PA 1..178 1..187 204 30.6 Plus
Dana\GF21441-PA 272 GF21441-PA 1..120 1..117 180 37.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:12:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10903-PA 189 GG10903-PA 1..189 1..189 991 100 Plus
Dere\GG23301-PA 170 GG23301-PA 1..168 1..185 309 38.9 Plus
Dere\GG18755-PA 170 GG18755-PA 1..168 1..185 308 38.9 Plus
Dere\GG12841-PA 235 GG12841-PA 1..145 1..142 206 34.5 Plus
Dere\GG19281-PA 171 GG19281-PA 1..171 1..188 184 28.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:13:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19192-PA 189 GH19192-PA 1..189 1..189 955 95.8 Plus
Dgri\GH24615-PA 170 GH24615-PA 1..168 1..185 308 38.9 Plus
Dgri\GH20317-PA 162 GH20317-PA 5..160 21..185 306 40.6 Plus
Dgri\GH17638-PA 204 GH17638-PA 1..137 1..137 214 36 Plus
Dgri\GH22004-PA 189 GH22004-PA 1..171 1..170 173 30.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:02
Subject Length Description Subject Range Query Range Score Percent Strand
elm-PB 189 CG2185-PB 1..189 1..189 969 100 Plus
elm-PA 189 CG2185-PA 1..189 1..189 969 100 Plus
CanB-PB 170 CG4209-PB 1..168 1..185 311 38.9 Plus
CanB-PA 170 CG4209-PA 1..168 1..185 311 38.9 Plus
CanB2-PB 170 CG11217-PB 1..168 1..185 308 38.9 Plus
CanB2-PA 170 CG11217-PA 1..168 1..185 308 38.9 Plus
CG32812-PB 225 CG32812-PB 1..203 1..185 228 31.4 Plus
CG32812-PA 225 CG32812-PA 1..203 1..185 228 31.4 Plus
Cib2-PB 189 CG9236-PB 1..171 1..170 180 32.4 Plus
Nca-PA 190 CG7641-PA 1..169 1..170 155 31.5 Plus
Eip63F-1-PB 161 CG15855-PB 8..160 31..174 150 28.9 Plus
CG14362-PA 206 CG14362-PA 23..191 17..183 147 26.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:13:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24225-PA 189 GI24225-PA 1..189 1..189 973 97.9 Plus
Dmoj\GI11077-PA 170 GI11077-PA 1..168 1..185 308 38.9 Plus
Dmoj\GI19990-PA 160 GI19990-PA 3..158 21..185 305 40.6 Plus
Dmoj\GI19707-PA 189 GI19707-PA 1..171 1..170 172 30.4 Plus
Dmoj\GI11334-PA 190 GI11334-PA 1..172 1..173 154 30.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:13:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23144-PA 189 GL23144-PA 1..189 1..189 974 98.4 Plus
Dper\GL10837-PA 170 GL10837-PA 1..168 1..185 309 38.9 Plus
Dper\GL14682-PA 170 GL14682-PA 1..168 1..185 308 38.9 Plus
Dper\GL14238-PA 227 GL14238-PA 1..193 1..185 193 28.5 Plus
Dper\GL14239-PA 225 GL14239-PA 10..191 12..185 185 28 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27156-PA 189 GA27156-PA 1..189 1..189 974 98.4 Plus
Dpse\GA24505-PA 305 GA24505-PA 147..303 20..185 311 41.6 Plus
Dpse\GA18033-PA 170 GA18033-PA 1..168 1..185 308 38.9 Plus
Dpse\GA17158-PA 230 GA17158-PA 1..193 1..185 192 28.5 Plus
Dpse\GA12933-PA 214 GA12933-PA 19..190 12..183 180 27.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10604-PA 105 GM10604-PA 1..105 85..189 545 100 Plus
Dsec\GM10603-PA 72 GM10603-PA 1..71 1..71 371 98.6 Plus
Dsec\GM20979-PA 170 GM20979-PA 1..168 1..185 309 38.9 Plus
Dsec\GM12403-PA 170 GM12403-PA 1..168 1..185 308 38.9 Plus
Dsec\GM19124-PA 225 GM19124-PA 1..203 1..185 231 32.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:13:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19593-PA 189 GD19593-PA 1..189 1..189 985 99.5 Plus
Dsim\GD15356-PA 170 GD15356-PA 1..168 1..185 309 38.9 Plus
Dsim\GD10507-PA 170 GD10507-PA 1..168 1..185 309 38.9 Plus
Dsim\GD14847-PA 190 GD14847-PA 1..172 1..173 158 31 Plus
Dsim\GD13311-PA 190 GD13311-PA 29..189 23..174 155 29.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:13:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10797-PA 189 GJ10797-PA 1..189 1..189 970 97.9 Plus
Dvir\GJ14779-PA 170 GJ14779-PA 1..168 1..185 308 38.9 Plus
Dvir\GJ21239-PA 177 GJ21239-PA 10..175 11..185 306 39.4 Plus
Dvir\GJ15774-PA 218 GJ15774-PA 1..116 1..128 196 33.6 Plus
Dvir\GJ15723-PA 228 GJ15723-PA 1..217 1..186 181 27.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:13:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10850-PA 189 GK10850-PA 1..189 1..189 975 98.4 Plus
Dwil\GK21716-PA 170 GK21716-PA 1..168 1..185 309 38.9 Plus
Dwil\GK10056-PA 170 GK10056-PA 1..168 1..185 308 38.9 Plus
Dwil\GK19964-PA 251 GK19964-PA 1..195 1..185 198 32.3 Plus
Dwil\GK25050-PA 221 GK25050-PA 1..121 1..133 194 36.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:13:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24150-PA 189 GE24150-PA 1..189 1..189 991 100 Plus
Dyak\GE19147-PA 170 GE19147-PA 1..168 1..185 309 38.9 Plus
Dyak\GE16397-PA 170 GE16397-PA 1..168 1..185 308 38.9 Plus
Dyak\GE16675-PA 228 GE16675-PA 1..204 1..185 217 29.4 Plus
Dyak\GE17871-PA 261 GE17871-PA 91..261 1..188 194 29.3 Plus