Clone LD19812 Report

Search the DGRC for LD19812

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:198
Well:12
Vector:pBS SK-
Associated Gene/Transcriptvnc-RA
Protein status:LD19812.pep: gold
Preliminary Size:1185
Sequenced Size:1020

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11989 2001-01-01 Release 2 assignment
CG11989 2001-10-10 Blastp of sequenced clone
CG11989 2003-01-01 Sim4 clustering to Release 3
Ard1 2008-04-29 Release 5.5 accounting
Ard1 2008-08-15 Release 5.9 accounting
CG42455 2008-12-18 5.12 accounting
Ard1 2008-12-18 5.12 accounting

Clone Sequence Records

LD19812.complete Sequence

1020 bp (1020 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061279

> LD19812.complete
TGGTGCCGGTGTATAAACTTAGTGTGGAAGAAGTGTGCTCATTCGCGAAT
ATAAATAAATTAAACAGCCAGGCTGGTTCCTCATCTGGAAGGCGTTTCTA
TCGAAATTTCGTCTGGTTCGAGAGCTGTTGGGTCAGGAGGAGCCGGAGGA
TCAGCAACCACTTGCTTGGGATCATCAGAATCAACAGCCACACCACCACG
GCAGAGCCAGGAAAGCTCGCCGAGACTAGGAAGCACATCTACACAGCCTC
ACCATGAACATCCGCTGCGCAAAACCGGAAGACCTAATGACCATGCAGCA
CTGCAATCTGCTGTGTCTACCCGAAAACTACCAGATGAAGTACTACTTTT
ACCACGGACTAACCTGGCCTCAGCTTAGCTACGTGGCCGTTGACGACAAG
GGCGCCATTGTGGGCTATGTCCTGGCCAAGATGGAGGAGCCGGAGCCCAA
TGAGGAGAGCCGCCATGGGCACATCACCTCGCTAGCGGTCAAGCGTTCCT
ATCGGCGATTGGGCCTGGCCCAGAAGCTCATGAATCAGGCCTCCCAGGCC
ATGGTCGAGTGCTTCAATGCCCAGTACGTGTCCCTGCACGTGAGGAAGAG
CAATCGGGCTGCCCTGAACCTCTACACCAACGCCCTCAAGTTCAAGATCA
TCGAGGTGGAGCCCAAGTACTATGCCGATGGCGAGGATGCATATGCCATG
CGACGCGACCTCAGCGAGTTTGCCGATGAGGATCAGGCCAAGGCTGCGAA
GCAGTCAGGCGAGGAGGAGGAGAAGGCGGTCCACAGATCCGGCGGACATG
GCCACTCGCACAACCACAGCGGTCACGATGGCCATTGTTGCTGAACACTT
TCGCTGCCGGCGCTTGCTGGCTTCGACGTTTTTTGCATTTTTGTGCATTA
GGGTTTTGTAATTATTTAACAATAAAAAACGTAACTAAAATTAAAACAAA
AGTAATGACAAAAAGATAATGTTTTTAACAATAAAGGGTTTGAAGGCCAT
TAAAAAAAAAAAAAAAAAAA

LD19812.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG42455-RC 1206 CG42455-RC 276..1206 71..1001 4655 100 Plus
Ard1-RC 1206 Ard1-RC 276..1206 71..1001 4655 100 Plus
CG42455-RB 1165 CG42455-RB 235..1165 71..1001 4655 100 Plus
CG42455-RC 1206 CG42455-RC 85..155 1..71 355 100 Plus
Ard1-RC 1206 Ard1-RC 85..155 1..71 355 100 Plus
CG42455-RB 1165 CG42455-RB 85..155 1..71 355 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9964878..9965810 69..1001 4665 100 Plus
chr3L 24539361 chr3L 9964114..9964185 1..72 360 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:07:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:00:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9973091..9974026 69..1004 4680 100 Plus
3L 28110227 3L 9972327..9972398 1..72 360 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9966191..9967126 69..1004 4680 100 Plus
3L 28103327 3L 9965427..9965498 1..72 360 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:00:14 has no hits.

LD19812.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:01:27 Download gff for LD19812.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9964114..9964184 1..71 100 -> Plus
chr3L 9964881..9965810 72..1001 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:54:16 Download gff for LD19812.complete
Subject Subject Range Query Range Percent Splice Strand
Ard1-RC 1..591 254..844 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:49:23 Download gff for LD19812.complete
Subject Subject Range Query Range Percent Splice Strand
Ard1-RC 1..591 254..844 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:48:10 Download gff for LD19812.complete
Subject Subject Range Query Range Percent Splice Strand
vnc-RD 1..591 254..844 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:18:09 Download gff for LD19812.complete
Subject Subject Range Query Range Percent Splice Strand
Ard1-RC 1..591 254..844 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:22:49 Download gff for LD19812.complete
Subject Subject Range Query Range Percent Splice Strand
vnc-RD 1..591 254..844 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:33:38 Download gff for LD19812.complete
Subject Subject Range Query Range Percent Splice Strand
CG42455-RB 85..158 1..71 95 -> Plus
CG42455-RB 236..1165 72..1001 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:49:23 Download gff for LD19812.complete
Subject Subject Range Query Range Percent Splice Strand
CG42455-RB 236..1165 72..1001 100   Plus
CG42455-RB 85..158 1..71 95 -> Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:48:10 Download gff for LD19812.complete
Subject Subject Range Query Range Percent Splice Strand
vnc-RB 16..1016 1..1001 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:18:10 Download gff for LD19812.complete
Subject Subject Range Query Range Percent Splice Strand
Ard1-RB 85..1085 1..1001 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:22:49 Download gff for LD19812.complete
Subject Subject Range Query Range Percent Splice Strand
vnc-RB 16..1016 1..1001 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:01:27 Download gff for LD19812.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9972327..9972397 1..71 100 -> Plus
3L 9973094..9974023 72..1001 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:01:27 Download gff for LD19812.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9972327..9972397 1..71 100 -> Plus
3L 9973094..9974023 72..1001 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:01:27 Download gff for LD19812.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9972327..9972397 1..71 100 -> Plus
3L 9973094..9974023 72..1001 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:48:10 Download gff for LD19812.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9965427..9965497 1..71 100 -> Plus
arm_3L 9966194..9967123 72..1001 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:55:07 Download gff for LD19812.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9966194..9967123 72..1001 100   Plus
3L 9965427..9965497 1..71 100 -> Plus

LD19812.pep Sequence

Translation from 253 to 843

> LD19812.pep
MNIRCAKPEDLMTMQHCNLLCLPENYQMKYYFYHGLTWPQLSYVAVDDKG
AIVGYVLAKMEEPEPNEESRHGHITSLAVKRSYRRLGLAQKLMNQASQAM
VECFNAQYVSLHVRKSNRAALNLYTNALKFKIIEVEPKYYADGEDAYAMR
RDLSEFADEDQAKAAKQSGEEEEKAVHRSGGHGHSHNHSGHDGHCC*

LD19812.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10586-PA 201 GF10586-PA 1..201 1..196 865 87.1 Plus
Dana\GF13618-PA 197 GF13618-PA 1..197 1..196 627 61.7 Plus
Dana\GF20277-PA 175 GF20277-PA 3..152 2..154 222 37.4 Plus
Dana\GF21684-PA 165 GF21684-PA 3..153 2..151 176 31.6 Plus
Dana\GF23106-PA 205 GF23106-PA 3..159 2..154 155 34.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:13:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15426-PA 196 GG15426-PA 1..196 1..196 945 95.9 Plus
Dere\GG18041-PA 175 GG18041-PA 3..152 2..154 225 37.4 Plus
Dere\GG12843-PA 358 GG12843-PA 232..354 22..150 143 33.3 Plus
Dere\GG23832-PA 203 GG23832-PA 5..158 4..154 139 29.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:13:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16055-PA 200 GH16055-PA 1..200 1..196 906 84.4 Plus
Dgri\GH24558-PA 175 GH24558-PA 3..152 2..154 230 38.1 Plus
Dgri\GH22808-PA 169 GH22808-PA 3..153 2..154 197 34.6 Plus
Dgri\GH25096-PA 182 GH25096-PA 3..155 2..154 191 32.9 Plus
Dgri\GH19626-PA 174 GH19626-PA 29..168 10..154 149 32.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:22
Subject Length Description Subject Range Query Range Score Percent Strand
vnc-PB 196 CG11989-PB 1..196 1..196 1054 100 Plus
vnc-PC 196 CG11989-PC 1..196 1..196 1054 100 Plus
vnc-PD 196 CG11989-PD 1..196 1..196 1054 100 Plus
vnc-PE 196 CG11989-PE 1..196 1..196 1054 100 Plus
vnc-PA 196 CG11989-PA 1..196 1..196 1054 100 Plus
Naa20A-PD 175 CG14222-PD 10..152 9..154 225 38.5 Plus
Naa20A-PC 175 CG14222-PC 10..152 9..154 225 38.5 Plus
Naa20A-PA 175 CG14222-PA 10..152 9..154 225 38.5 Plus
Naa20A-PB 180 CG14222-PB 10..152 9..154 225 38.5 Plus
CG31730-PA 162 CG31730-PA 10..153 9..151 155 32.4 Plus
Naa20B-PB 204 CG31851-PB 10..163 9..158 149 30.2 Plus
Naa20B-PA 204 CG31851-PA 10..163 9..158 149 30.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:13:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12318-PA 196 GI12318-PA 1..196 1..196 898 85.2 Plus
Dmoj\GI16318-PA 175 GI16318-PA 3..152 2..154 228 38.1 Plus
Dmoj\GI20782-PA 183 GI20782-PA 25..169 24..168 202 35.1 Plus
Dmoj\GI20771-PA 204 GI20771-PA 10..164 9..158 173 30.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:13:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12574-PA 160 GL12574-PA 1..143 1..143 758 97.9 Plus
Dper\GL23518-PA 178 GL23518-PA 3..152 2..154 231 39.4 Plus
Dper\GL27103-PA 175 GL27103-PA 3..152 2..154 223 37.4 Plus
Dper\GL26694-PA 182 GL26694-PA 3..157 2..155 202 35.8 Plus
Dper\GL14242-PA 391 GL14242-PA 265..387 22..150 142 33.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:13:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11315-PA 201 GA11315-PA 1..173 1..173 858 91.3 Plus
Dpse\GA27286-PA 178 GA27286-PA 3..152 2..154 231 39.4 Plus
Dpse\GA22686-PA 175 GA22686-PA 3..152 2..154 223 37.4 Plus
Dpse\GA16428-PA 182 GA16428-PA 3..157 2..155 198 35.8 Plus
Dpse\GA16524-PA 203 GA16524-PA 3..161 2..154 157 31.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:13:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25199-PA 196 GM25199-PA 1..196 1..196 1061 100 Plus
Dsec\GM25705-PA 162 GM25705-PA 3..153 2..151 156 31.6 Plus
Dsec\GM10355-PA 204 GM10355-PA 5..163 4..158 139 29 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:13:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14230-PA 196 GD14230-PA 1..196 1..196 1061 100 Plus
Dsim\GD22076-PA 162 GD22076-PA 3..153 2..151 161 32.3 Plus
Dsim\GD23882-PA 204 GD23882-PA 5..163 4..158 142 29.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:13:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13255-PA 195 GJ13255-PA 1..195 1..196 907 86.5 Plus
Dvir\GJ15656-PA 175 GJ15656-PA 3..152 2..154 216 36.8 Plus
Dvir\GJ17963-PA 184 GJ17963-PA 25..155 24..154 212 37.6 Plus
Dvir\GJ18937-PA 391 GJ18937-PA 265..387 22..150 142 33.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:13:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17457-PA 201 GK17457-PA 1..201 1..196 904 84.7 Plus
Dwil\GK24995-PA 187 GK24995-PA 3..152 2..154 225 37.4 Plus
Dwil\GK19033-PA 196 GK19033-PA 4..151 3..153 169 31.4 Plus
Dwil\GK15295-PA 227 GK15295-PA 3..152 2..155 165 32.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21734-PA 196 GE21734-PA 1..196 1..196 945 95.9 Plus
Dyak\GE17370-PA 175 GE17370-PA 3..152 2..154 225 37.4 Plus
Dyak\GE11776-PA 157 GE11776-PA 3..126 2..126 152 32.3 Plus
Dyak\GE18637-PA 204 GE18637-PA 5..163 4..158 143 31.7 Plus
Dyak\GE16678-PA 354 GE16678-PA 228..350 22..150 143 33.3 Plus

LD19812.hyp Sequence

Translation from 253 to 843

> LD19812.hyp
MNIRCAKPEDLMTMQHCNLLCLPENYQMKYYFYHGLTWPQLSYVAVDDKG
AIVGYVLAKMEEPEPNEESRHGHITSLAVKRSYRRLGLAQKLMNQASQAM
VECFNAQYVSLHVRKSNRAALNLYTNALKFKIIEVEPKYYADGEDAYAMR
RDLSEFADEDQAKAAKQSGEEEEKAVHRSGGHGHSHNHSGHDGHCC*

LD19812.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
vnc-PB 196 CG11989-PB 1..196 1..196 1054 100 Plus
vnc-PC 196 CG11989-PC 1..196 1..196 1054 100 Plus
vnc-PD 196 CG11989-PD 1..196 1..196 1054 100 Plus
vnc-PE 196 CG11989-PE 1..196 1..196 1054 100 Plus
vnc-PA 196 CG11989-PA 1..196 1..196 1054 100 Plus