Clone LD20271 Report

Search the DGRC for LD20271

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:202
Well:71
Vector:pBS SK-
Associated Gene/TranscriptCks30A-RA
Protein status:LD20271.pep: gold
Preliminary Size:1295
Sequenced Size:1147

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3738 2001-01-01 Release 2 assignment
CG3738 2001-10-10 Blastp of sequenced clone
CG3738 2003-01-01 Sim4 clustering to Release 3
Cks30A 2008-04-29 Release 5.5 accounting
Cks30A 2008-08-15 Release 5.9 accounting
Cks30A 2008-12-18 5.12 accounting

Clone Sequence Records

LD20271.complete Sequence

1147 bp (1147 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061285

> LD20271.complete
CTTATATCTAGCGCGTCACTTGATTTTAAAAATTTCCAAACCAAACGTAA
ATTCCAGCACAATAATCAACCTGAATAGTGATAAAAACCGAGAAACTCGT
ACCTAAAAAGCAGTTGCAGTGTTTGCCAATTGATTCAACACCACGGCTAA
AGTTGCGACATCGAATCCGCAGGAGCCGCCTTCGACGGTCCAAAAAAGAG
ACGCCAAATTCCGCAGCGCGCACTTCGCCTTTCCATTGCATCGAAATTCC
TGGAATTTCCAGGCGCAGACACGATGAGCAAGGACATTTACTACTCCGAC
AAGTACTACGATGAGCAGTTCGAGTACAGACATGTGGTTTTGCCAAAAGA
GCTGGTAAAAATGGTGCCCAAGACTCATCTGATGACGGAGGCCGAGTGGC
GATCAATTGGCGTACAGCAGTCGCGCGGATGGATCCACTACATGATCCAT
AAGCCGGAGCCCCACATCCTCCTGTTTCGGCGACCCAAAACGGATTAGAT
AACCGGCGGTAGCAGCAGCAGTAGCAACAACAACTGCATCAGATACACAT
ACTTCGAAACCACATAGCCTGTAGCACATACCTATATATCCGGCAGCTGC
TGCCGATATTCTGTATTGGCGGTGGTGGTGGTTGCTGCCAAACAAACAAC
CAACTGTTGCACAAACATCAACAACATCATCATCATCATCATTATCATAG
GTACTCAGGAATCCCCTAGAAACTACTTATTGTGCTGTTTGTGCTTTGTA
ATACTCTCTTTTTACCATGTTTGCCCCGCATTATTCCCTTTTATATATAT
AGCACCTAGAGCTAATGATAAGTTTGCCATTTGTAATACTCTCTTTTTAC
CATGTTTGCCCCGCATTATCCCCTTTTATATATGTAGCACCTAGAGCTAA
TGATGTTTGCCATTTTCGTACACCTTAGTGCCGTTTCCGAATCATTCCTC
AAGTTCGCACGAATTTTATCATACTTTATGTTGCCATTTCGAAACGGAAG
CGAAAAGAAGAATTTTGCTCACTTCTTTTAAGCTTAAATGAAATCTGATT
TGTGATCTTGAAATTTTTAATCAATAATACATATGTTTACACATAATATA
ATGAACTTAAAATAAATATTTTTAATGTAAAAAAAAAAAAAAAAAAA

LD20271.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:51
Subject Length Description Subject Range Query Range Score Percent Strand
Cks30A-RA 1298 Cks30A-RA 26..1154 1..1129 5645 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:53:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9330114..9330916 326..1128 4000 99.9 Plus
chr2L 23010047 chr2L 9329717..9330045 1..329 1645 100 Plus
chr2L 23010047 chr2L 9330533..9330607 830..904 345 97.3 Plus
chr2L 23010047 chr2L 9330618..9330692 745..819 345 97.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:07:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:53:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9331179..9331982 326..1129 4020 100 Plus
2L 23513712 2L 9330782..9331110 1..329 1645 100 Plus
2L 23513712 2L 9331598..9331672 830..904 345 97.3 Plus
2L 23513712 2L 9331683..9331757 745..819 345 97.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9331179..9331982 326..1129 4020 100 Plus
2L 23513712 2L 9330782..9331110 1..329 1645 100 Plus
Blast to na_te.dros performed 2019-03-16 10:53:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2344..2544 502..696 143 55.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2347..2401 511..564 137 74.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2253..2487 358..600 133 56 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2452..2644 511..697 130 58.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2377..2466 511..600 125 62.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2791..2836 502..547 122 73.9 Plus
gypsy11 4428 gypsy11 GYPSY11 4428bp 968..1012 500..544 117 73.3 Plus
Doc3-element 4740 Doc3-element DOC3 4740bp 528..569 510..550 117 78.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2323..2354 511..542 115 84.4 Plus
1360 3409 1360 1360 3409bp 2499..2553 1097..1042 115 69.6 Minus
TART-A 13424 TART-A 13424bp 910..939 513..542 114 86.7 Plus
TART-A 13424 TART-A 13424bp 12088..12117 513..542 114 86.7 Plus

LD20271.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:54:06 Download gff for LD20271.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9329717..9330045 1..329 100 -> Plus
chr2L 9330118..9330916 330..1128 95   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:54:38 Download gff for LD20271.complete
Subject Subject Range Query Range Percent Splice Strand
Cks30A-RA 1..225 274..498 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:49:26 Download gff for LD20271.complete
Subject Subject Range Query Range Percent Splice Strand
Cks30A-RA 1..225 274..498 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:05:04 Download gff for LD20271.complete
Subject Subject Range Query Range Percent Splice Strand
Cks30A-RA 1..225 274..498 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 20:18:11 has no hits.
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:20:25 Download gff for LD20271.complete
Subject Subject Range Query Range Percent Splice Strand
Cks30A-RA 1..225 274..498 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:33:42 Download gff for LD20271.complete
Subject Subject Range Query Range Percent Splice Strand
Cks30A-RA 16..1143 1..1128 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:49:26 Download gff for LD20271.complete
Subject Subject Range Query Range Percent Splice Strand
Cks30A-RA 16..1143 1..1128 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:05:04 Download gff for LD20271.complete
Subject Subject Range Query Range Percent Splice Strand
Cks30A-RA 20..1147 1..1128 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:18:11 Download gff for LD20271.complete
Subject Subject Range Query Range Percent Splice Strand
Cks30A-RA 16..1143 1..1128 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:20:25 Download gff for LD20271.complete
Subject Subject Range Query Range Percent Splice Strand
Cks30A-RA 20..1147 1..1128 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:54:06 Download gff for LD20271.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9330782..9331110 1..329 100 -> Plus
2L 9331183..9331981 330..1128 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:54:06 Download gff for LD20271.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9330782..9331110 1..329 100 -> Plus
2L 9331183..9331981 330..1128 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:54:06 Download gff for LD20271.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9330782..9331110 1..329 100 -> Plus
2L 9331183..9331981 330..1128 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:05:04 Download gff for LD20271.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9330782..9331110 1..329 100 -> Plus
arm_2L 9331183..9331981 330..1128 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:55:09 Download gff for LD20271.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9330782..9331110 1..329 100 -> Plus
2L 9331183..9331981 330..1128 100   Plus

LD20271.hyp Sequence

Translation from 273 to 497

> LD20271.hyp
MSKDIYYSDKYYDEQFEYRHVVLPKELVKMVPKTHLMTEAEWRSIGVQQS
RGWIHYMIHKPEPHILLFRRPKTD*

LD20271.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:16:04
Subject Length Description Subject Range Query Range Score Percent Strand
Cks30A-PA 74 CG3738-PA 1..74 1..74 407 100 Plus
Cks85A-PC 96 CG9790-PC 6..73 5..72 288 67.6 Plus
Cks85A-PB 96 CG9790-PB 6..73 5..72 288 67.6 Plus
Cks85A-PA 96 CG9790-PA 6..73 5..72 288 67.6 Plus

LD20271.pep Sequence

Translation from 273 to 497

> LD20271.pep
MSKDIYYSDKYYDEQFEYRHVVLPKELVKMVPKTHLMTEAEWRSIGVQQS
RGWIHYMIHKPEPHILLFRRPKTD*

LD20271.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22718-PA 75 GF22718-PA 1..74 1..74 384 97.3 Plus
Dana\GF16842-PA 98 GF16842-PA 3..75 2..74 282 63 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:13:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25340-PA 74 GG25340-PA 1..74 1..74 390 100 Plus
Dere\GG17431-PA 96 GG17431-PA 3..71 2..70 275 66.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:13:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13319-PA 75 GH13319-PA 1..74 1..74 377 95.9 Plus
Dgri\GH19019-PA 99 GH19019-PA 3..71 2..70 281 66.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:16
Subject Length Description Subject Range Query Range Score Percent Strand
Cks30A-PA 74 CG3738-PA 1..74 1..74 407 100 Plus
Cks85A-PC 96 CG9790-PC 6..73 5..72 288 67.6 Plus
Cks85A-PB 96 CG9790-PB 6..73 5..72 288 67.6 Plus
Cks85A-PA 96 CG9790-PA 6..73 5..72 288 67.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:13:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12276-PA 75 GI12276-PA 1..74 1..74 371 93.2 Plus
Dmoj\GI22832-PA 93 GI22832-PA 3..71 2..70 274 65.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:13:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12136-PA 91 GL12136-PA 3..71 2..70 278 66.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:13:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25305-PA 75 GA25305-PA 1..74 1..74 368 93.2 Plus
Dpse\GA22037-PA 91 GA22037-PA 3..71 2..70 278 66.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:13:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17424-PA 74 GM17424-PA 1..74 1..74 390 100 Plus
Dsec\GM26323-PA 96 GM26323-PA 3..71 2..70 275 66.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:13:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23595-PA 74 GD23595-PA 1..74 1..74 390 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:13:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17855-PA 75 GJ17855-PA 1..74 1..74 374 94.6 Plus
Dvir\GJ24587-PA 93 GJ24587-PA 3..71 2..70 280 66.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:13:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11278-PA 99 GK11278-PA 3..75 2..74 289 67.1 Plus
Dwil\GK15078-PA 59 GK15078-PA 1..52 1..52 258 92.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:13:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18832-PA 74 GE18832-PA 1..74 1..74 390 100 Plus
Dyak\GE24833-PA 96 GE24833-PA 3..71 2..70 276 66.7 Plus