Clone LD20432 Report

Search the DGRC for LD20432

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:204
Well:32
Vector:pBS SK-
Associated Gene/TranscriptCG10395-RA
Protein status:LD20432.pep: validated full length
Preliminary Size:1161
Sequenced Size:1018

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10395 2001-01-01 Release 2 assignment
CG10395 2001-10-10 Blastp of sequenced clone
CG10395 2003-01-01 Sim4 clustering to Release 3
CG10395 2008-04-29 Release 5.5 accounting

Clone Sequence Records

LD20432.complete Sequence

1018 bp (1018 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061289

> LD20432.complete
AAAGAACTTCATTACACTACAGATGCGCTTGCATCTAATTCAAATATTCA
TGAACATCCTCTTAGACGCACGAGAAATATTAGCACAAAAAAATTGGCAC
ATGATGACAGTTTGCCTCACACGGGTGCTAAAAAAGGTAAAAGACGACGC
AACAGTGATACGTCCAGTGAAGAGGATCGGTGGCTTACCGCCATAGAAAC
CGGGAAACTAGACGTTGTTGATGAGGAACTTAAAAAGATAAAGGACCCCA
AACTTATGACAGCACGTCAACGTGCTATTTATGAACGGACACAGGACTCC
GAAATAAATGGATTTATAGAAGAGCTAATTGCTCTTCCAAGTGGTTATAA
AGAAAAGGAAAAGCCGCAGACTGCGGAGGAAATTCATAAAGCTCTTCTGA
AATCTCAAAAACGAAAACAACAAGCTGACGAACGCAGAGAAAAAGATAAA
TTAAAGACAATGGAGCGGTTGTTAAAAAAACAGGCAACCAACAGGGATCG
GATTTCAATTCGCAATAAGTCTTTACAACAGCCCTCTTATCCAAAAATAA
CCTATATAAGTGCTGTAACTGGCAACTATGTAATAGTTCCCCCAGGTTAC
GAATATCCTTTAAAAGTTCAACTCCCTCGTACACCTCCTCCTTCACAGGT
GTGCTTTGTAAGCGGTTGTGAAAATCGCAAGACATATAATTGTTCAACAA
CAAATGTTCCATTATGTAGTCTTACATGTTATCGTAAGAATATCAACAAA
ATAAGAAAAACGTCTACAAATACGTAGATTTAATTTTAATATTGATTGAC
AAAAAAATTGTTTATTATTTCATGTTGCTCCGTTTCAATTCGCTGTAAAA
ACTGCAATTCGCCTTTTAAGCGTTCAAGTTCTACTGTTTGCTCAAATATC
TCATATTGATAGACTTGCTGCTTGTTCTGGCGCTGAATAAATGCCGTTTT
TAATTGATTTTGAGTACCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAA

LD20432.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG10395-RA 1454 CG10395-RA 386..1355 1..970 4850 100 Plus
CG30441-RB 410 CG30441-RB 218..410 970..778 965 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:31:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 1238352..1239319 1..968 4810 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:07:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:31:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 5350936..5351905 1..970 4850 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 5352135..5353104 1..970 4850 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:31:39 has no hits.

LD20432.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:32:29 Download gff for LD20432.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 1238352..1239319 1..968 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:54:46 Download gff for LD20432.complete
Subject Subject Range Query Range Percent Splice Strand
CG10395-RA 166..942 1..777 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:49:09 Download gff for LD20432.complete
Subject Subject Range Query Range Percent Splice Strand
CG10395-RA 166..942 1..777 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:13:27 Download gff for LD20432.complete
Subject Subject Range Query Range Percent Splice Strand
CG10395-RA 166..942 1..777 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:17:58 Download gff for LD20432.complete
Subject Subject Range Query Range Percent Splice Strand
CG10395-RA 166..942 1..777 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:44:17 Download gff for LD20432.complete
Subject Subject Range Query Range Percent Splice Strand
CG10395-RD 70..846 1..777 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:33:20 Download gff for LD20432.complete
Subject Subject Range Query Range Percent Splice Strand
CG10395-RA 386..1353 1..968 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:49:09 Download gff for LD20432.complete
Subject Subject Range Query Range Percent Splice Strand
CG10395-RA 386..1353 1..968 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:13:27 Download gff for LD20432.complete
Subject Subject Range Query Range Percent Splice Strand
CG10395-RA 402..1369 1..968 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:17:58 Download gff for LD20432.complete
Subject Subject Range Query Range Percent Splice Strand
CG10395-RA 386..1353 1..968 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:44:17 Download gff for LD20432.complete
Subject Subject Range Query Range Percent Splice Strand
CG10395-RD 139..1106 1..968 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:29 Download gff for LD20432.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5350936..5351903 1..968 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:29 Download gff for LD20432.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5350936..5351903 1..968 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:29 Download gff for LD20432.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5350936..5351903 1..968 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:13:27 Download gff for LD20432.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1238441..1239408 1..968 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:54:53 Download gff for LD20432.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5352135..5353102 1..968 100   Plus

LD20432.hyp Sequence

Translation from 0 to 776

> LD20432.hyp
KELHYTTDALASNSNIHEHPLRRTRNISTKKLAHDDSLPHTGAKKGKRRR
NSDTSSEEDRWLTAIETGKLDVVDEELKKIKDPKLMTARQRAIYERTQDS
EINGFIEELIALPSGYKEKEKPQTAEEIHKALLKSQKRKQQADERREKDK
LKTMERLLKKQATNRDRISIRNKSLQQPSYPKITYISAVTGNYVIVPPGY
EYPLKVQLPRTPPPSQVCFVSGCENRKTYNCSTTNVPLCSLTCYRKNINK
IRKTSTNT*

LD20432.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:15:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG10395-PE 281 CG10395-PE 24..281 1..258 1342 100 Plus
CG10395-PD 281 CG10395-PD 24..281 1..258 1342 100 Plus

LD20432.pep Sequence

Translation from 255 to 776

> LD20432.pep
MTARQRAIYERTQDSEINGFIEELIALPSGYKEKEKPQTAEEIHKALLKS
QKRKQQADERREKDKLKTMERLLKKQATNRDRISIRNKSLQQPSYPKITY
ISAVTGNYVIVPPGYEYPLKVQLPRTPPPSQVCFVSGCENRKTYNCSTTN
VPLCSLTCYRKNINKIRKTSTNT*

LD20432.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:12:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20009-PA 167 GF20009-PA 1..162 1..163 538 61.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:12:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23156-PA 176 GG23156-PA 1..175 1..170 785 87.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21736-PA 313 GH21736-PA 145..313 1..166 574 63.3 Plus
Dgri\GH23731-PA 273 GH23731-PA 105..273 1..166 573 63.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG10395-PE 281 CG10395-PE 109..281 1..173 900 100 Plus
CG10395-PD 281 CG10395-PD 109..281 1..173 900 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18879-PA 168 GI18879-PA 1..165 1..163 573 65.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:12:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11052-PA 179 GL11052-PA 1..165 1..163 629 67.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:12:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10297-PA 179 GA10297-PA 1..165 1..163 629 67.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11102-PA 177 GM11102-PA 1..177 1..173 823 89.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10370-PA 177 GD10370-PA 1..177 1..173 832 91.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:12:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21913-PA 169 GJ21913-PA 1..169 1..166 580 66.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:12:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21947-PA 314 GK21947-PA 138..310 1..170 582 65.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:12:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11367-PA 168 GE11367-PA 1..163 1..163 792 91.4 Plus