Clone LD20439 Report

Search the DGRC for LD20439

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:204
Well:39
Vector:pBS SK-
Associated Gene/TranscriptSamDC-RA
Protein status:LD20439.pep: gold
Preliminary Size:1355
Sequenced Size:1234

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5029 2001-01-01 Release 2 assignment
CG5029 2003-01-01 Sim4 clustering to Release 3
CG5029 2004-08-12 Blastp of sequenced clone
SamDC 2008-04-29 Release 5.5 accounting
SamDC 2008-08-15 Release 5.9 accounting
SamDC 2008-12-18 5.12 accounting

Clone Sequence Records

LD20439.complete Sequence

1234 bp (1234 high quality bases) assembled on 2004-08-12

GenBank Submission: BT021946

> LD20439.complete
TTTTGGTATCAGATCAGATCCATTTGTTATTGCCAGCCAGCAGCATGTTG
GAGAACGGTTCGCACTTCTTCGAGGGCGTTGAGAAACTCCTTGAGATTTG
GTTTGAGGAGAGCTCCAACGGTGACGATGATCTGCGTAACATCAGCAGAT
CTGATTGGGAAAACGTGCTTAGCAATGTCAACTGTCAAATAATAAGCACA
TCCAAAAACGACATTATTGATGCTTTTGTGTTAAGTGAGAGCAGTATGTT
TGTTTCAAAGCGACGATGGATCCTTAAAACTTGTGGAACGACTACTCCAT
TGAAATGCCTGGGTCAGTTGCTTAAGCTGGCTGAGGCCAATGGATACAAT
GTGGTCGCAGACTTGTTCTACTCGCGAAAAAATTTCACTAGACCGGAGGC
GCAGATAACTCCCCATCAAGGCTTTACGGAGGAAGTTACGTATCTGGACT
CAATTTTTCCCAACGGAAGATCCTATTGTCTGGGCTCCATGAACCTGGAG
TGTTGGTACCTCTACACTTTTAGTCGTTCTGATATCAAAATTACGCCCCA
ACTTATATCGGATGAGAAAAACGTTGACTCCGATCCAGATCAAACTATTG
AAATATTAATGCAAGATCTAGATCCCGAAACCATGTCAATCTTCTATAAA
AACAAGTTTAATGATGCTAATGGCGCTACTGTGAAATCTGGTATCGATAC
CATATTGCCGACTATGCACATTGATGACTTTTTGTTCGATCCTTGCGGCT
ACTCCATGAATGGAATCAACGATAAGGGGGAGTACATGACAATTCATATT
ACTCCGGAGAATCAATTTTCGTATGTGAGCTTCGAAACAAATGTGGCTCT
AAGTAACTATCGTAAACTTATCAATCAAGTAATCAATACTTTCAAGCCGG
GAAAGTTTATTGTAACCATCTTTGCCAATAAGTGCTCGTTGGCCTACGAA
ACTATGAAGGAACTGGAAGTGGAGTACTCACAGGGATCGCACTGGAAACG
AACCGACATGCAATGTTGCAACTTTCCATCTTACAATCTTCTGTTTGCAC
AATATTCCCACAGTGAGAAAACTGGTGATAATTTATAAAATTCCAAAGCC
AACAGCAATTGTGATTGTTTTGCGTATGTCTAACAAAATTTATTTTTCGT
TCGTTATTAATTATTCAAAATAAATGTCGAATAAATAAAATAATAAATAC
TACTACTACTAAAAAAAAAAAAAAAAAAAAAAAA

LD20439.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:59:06
Subject Length Description Subject Range Query Range Score Percent Strand
SamDC-RA 1340 SamDC-RA 124..1336 1..1213 6065 100 Plus
SamDC-RB 795 SamDC-RB 31..434 1..404 2020 100 Plus
SamDC-RB 795 SamDC-RB 485..766 402..683 1410 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:58:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10339382..10339663 402..683 1410 100 Plus
chr2L 23010047 chr2L 10340076..10340355 931..1210 1400 100 Plus
chr2L 23010047 chr2L 10339161..10339331 234..404 855 100 Plus
chr2L 23010047 chr2L 10339858..10340015 775..932 790 100 Plus
chr2L 23010047 chr2L 10338320..10338467 1..148 740 100 Plus
chr2L 23010047 chr2L 10339718..10339812 683..777 475 100 Plus
chr2L 23010047 chr2L 10339001..10339090 146..235 450 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:07:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10341224..10341506 931..1213 1415 100 Plus
2L 23513712 2L 10340530..10340811 402..683 1410 100 Plus
2L 23513712 2L 10340309..10340479 234..404 855 100 Plus
2L 23513712 2L 10341006..10341163 775..932 790 100 Plus
2L 23513712 2L 10339471..10339618 1..148 740 100 Plus
2L 23513712 2L 10340866..10340960 683..777 475 100 Plus
2L 23513712 2L 10340149..10340238 146..235 450 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10341224..10341506 931..1213 1415 100 Plus
2L 23513712 2L 10340530..10340811 402..683 1410 100 Plus
2L 23513712 2L 10340309..10340479 234..404 855 100 Plus
2L 23513712 2L 10341006..10341163 775..932 790 100 Plus
2L 23513712 2L 10339471..10339618 1..148 740 100 Plus
2L 23513712 2L 10340866..10340960 683..777 475 100 Plus
2L 23513712 2L 10340149..10340238 146..235 450 100 Plus
Blast to na_te.dros performed 2019-03-15 21:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
accord 7404 accord ACCORD 7404bp 3922..3991 720..649 111 65.3 Minus

LD20439.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:59:41 Download gff for LD20439.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10338320..10338467 1..148 100 -> Plus
chr2L 10339004..10339090 149..235 100 -> Plus
chr2L 10339163..10339331 236..404 100 -> Plus
chr2L 10339385..10339663 405..683 100 -> Plus
chr2L 10339719..10339811 684..776 100 -> Plus
chr2L 10339860..10340015 777..932 100 -> Plus
chr2L 10340078..10340355 933..1210 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:54:47 Download gff for LD20439.complete
Subject Subject Range Query Range Percent Splice Strand
SamDC-RA 1..1044 45..1088 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:33:21 Download gff for LD20439.complete
Subject Subject Range Query Range Percent Splice Strand
SamDC-RA 1..1044 45..1088 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:04:17 Download gff for LD20439.complete
Subject Subject Range Query Range Percent Splice Strand
SamDC-RA 1..1044 45..1088 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:17:14 Download gff for LD20439.complete
Subject Subject Range Query Range Percent Splice Strand
SamDC-RA 1..1044 45..1088 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:08:21 Download gff for LD20439.complete
Subject Subject Range Query Range Percent Splice Strand
SamDC-RA 1..1044 45..1088 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:39:09 Download gff for LD20439.complete
Subject Subject Range Query Range Percent Splice Strand
SamDC-RA 1..1210 1..1210 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:33:21 Download gff for LD20439.complete
Subject Subject Range Query Range Percent Splice Strand
SamDC-RA 1..1210 1..1210 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:04:17 Download gff for LD20439.complete
Subject Subject Range Query Range Percent Splice Strand
SamDC-RA 15..1224 1..1210 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:17:14 Download gff for LD20439.complete
Subject Subject Range Query Range Percent Splice Strand
SamDC-RA 12..1221 1..1210 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:08:21 Download gff for LD20439.complete
Subject Subject Range Query Range Percent Splice Strand
SamDC-RA 15..1224 1..1210 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:41 Download gff for LD20439.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10340867..10340959 684..776 100 -> Plus
2L 10341008..10341163 777..932 100 -> Plus
2L 10341226..10341503 933..1210 100   Plus
2L 10339471..10339618 1..148 100 -> Plus
2L 10340152..10340238 149..235 100 -> Plus
2L 10340311..10340479 236..404 100 -> Plus
2L 10340533..10340811 405..683 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:41 Download gff for LD20439.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10340867..10340959 684..776 100 -> Plus
2L 10341008..10341163 777..932 100 -> Plus
2L 10341226..10341503 933..1210 100   Plus
2L 10339471..10339618 1..148 100 -> Plus
2L 10340152..10340238 149..235 100 -> Plus
2L 10340311..10340479 236..404 100 -> Plus
2L 10340533..10340811 405..683 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:41 Download gff for LD20439.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10340867..10340959 684..776 100 -> Plus
2L 10341008..10341163 777..932 100 -> Plus
2L 10341226..10341503 933..1210 100   Plus
2L 10339471..10339618 1..148 100 -> Plus
2L 10340152..10340238 149..235 100 -> Plus
2L 10340311..10340479 236..404 100 -> Plus
2L 10340533..10340811 405..683 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:04:17 Download gff for LD20439.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10340867..10340959 684..776 100 -> Plus
arm_2L 10341008..10341163 777..932 100 -> Plus
arm_2L 10339471..10339618 1..148 100 -> Plus
arm_2L 10340152..10340238 149..235 100 -> Plus
arm_2L 10340311..10340479 236..404 100 -> Plus
arm_2L 10340533..10340811 405..683 100 -> Plus
arm_2L 10341226..10341503 933..1210 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:54:17 Download gff for LD20439.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10340533..10340811 405..683 100 -> Plus
2L 10340867..10340959 684..776 100 -> Plus
2L 10341008..10341163 777..932 100 -> Plus
2L 10341226..10341503 933..1210 100   Plus
2L 10339471..10339618 1..148 100 -> Plus
2L 10340152..10340238 149..235 100 -> Plus
2L 10340311..10340479 236..404 100 -> Plus

LD20439.hyp Sequence

Translation from 2 to 1087

> LD20439.hyp
LVSDQIHLLLPASSMLENGSHFFEGVEKLLEIWFEESSNGDDDLRNISRS
DWENVLSNVNCQIISTSKNDIIDAFVLSESSMFVSKRRWILKTCGTTTPL
KCLGQLLKLAEANGYNVVADLFYSRKNFTRPEAQITPHQGFTEEVTYLDS
IFPNGRSYCLGSMNLECWYLYTFSRSDIKITPQLISDEKNVDSDPDQTIE
ILMQDLDPETMSIFYKNKFNDANGATVKSGIDTILPTMHIDDFLFDPCGY
SMNGINDKGEYMTIHITPENQFSYVSFETNVALSNYRKLINQVINTFKPG
KFIVTIFANKCSLAYETMKELEVEYSQGSHWKRTDMQCCNFPSYNLLFAQ
YSHSEKTGDNL*

LD20439.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
SamDC-PA 347 CG5029-PA 1..347 15..361 1849 100 Plus

LD20439.pep Sequence

Translation from 44 to 1087

> LD20439.pep
MLENGSHFFEGVEKLLEIWFEESSNGDDDLRNISRSDWENVLSNVNCQII
STSKNDIIDAFVLSESSMFVSKRRWILKTCGTTTPLKCLGQLLKLAEANG
YNVVADLFYSRKNFTRPEAQITPHQGFTEEVTYLDSIFPNGRSYCLGSMN
LECWYLYTFSRSDIKITPQLISDEKNVDSDPDQTIEILMQDLDPETMSIF
YKNKFNDANGATVKSGIDTILPTMHIDDFLFDPCGYSMNGINDKGEYMTI
HITPENQFSYVSFETNVALSNYRKLINQVINTFKPGKFIVTIFANKCSLA
YETMKELEVEYSQGSHWKRTDMQCCNFPSYNLLFAQYSHSEKTGDNL*

LD20439.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:17:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15768-PA 349 GF15768-PA 1..349 1..347 1645 90 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:17:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10109-PA 347 GG10109-PA 1..347 1..347 1780 95.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:17:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24050-PA 344 GH24050-PA 1..339 2..340 1397 74.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:12
Subject Length Description Subject Range Query Range Score Percent Strand
SamDC-PA 347 CG5029-PA 1..347 1..347 1849 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:17:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21472-PA 355 GI21472-PA 8..350 2..340 1338 72.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18975-PA 346 GL18975-PA 1..341 1..342 1507 81 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:17:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18181-PA 347 GM18181-PA 1..347 1..347 1858 99.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23679-PA 317 GD23679-PA 5..317 35..347 1682 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16493-PA 344 GJ16493-PA 5..339 6..340 1398 75.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:17:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24064-PA 163 GK24064-PA 1..126 121..246 454 65.9 Plus
Dwil\GK19329-PA 101 GK19329-PA 1..98 245..342 438 82.7 Plus
Dwil\GK18922-PA 98 GK18922-PA 1..95 248..342 421 82.1 Plus
Dwil\GK24062-PA 100 GK24062-PA 1..89 33..121 344 70.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:17:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\SamDC-PA 347 GE18924-PA 1..347 1..347 1797 94.8 Plus