Clone LD21289 Report

Search the DGRC for LD21289

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:212
Well:89
Vector:pOT2
Associated Gene/TranscriptDf31-RA
Protein status:LD21289.pep: gold
Preliminary Size:1300
Sequenced Size:833

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2207 2001-01-01 Release 2 assignment
CG2207 2001-07-04 Blastp of sequenced clone
CG2207 2003-01-01 Sim4 clustering to Release 3
Df31 2008-04-29 Release 5.5 accounting
Df31 2008-08-15 Release 5.9 accounting
Df31 2008-12-18 5.12 accounting

Clone Sequence Records

LD21289.complete Sequence

833 bp (833 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051664

> LD21289.complete
GACGTTCTTAATTGTACGGCAAAATCTCCAGCAACCAAGCTACTTTCTTA
GCAAAGCTACTAAAGAGGAAACTATATTGATAAAATTTCGTTCTTTTAAA
ATCTTTGTGCTGATATTTAAGGCGTGCTTGGTGATCCAAAAACCCTCAGT
TACAACGTGTTTTCTCGCTTCGCGTTTGAAAAGTAATATCTAACAGTAAT
TCAAAATGGCTGATGTGGCTGAGCAAAAGAATGAGACCCCTGTTGTCGAG
AAGGTCGCAGCTGAGGAAGTTGATGCTGTGAAGAAAGATGCAGTTGCCGC
CGAGGAGGTAGCAGCTGAGAAGGCGAGCATCACAGAAAACGGTGGCGCCG
AAGAGGAGAGCGTAGCCAAGGAGAACGGAGCCGCCGACAGCAGCGCGACC
GAGCCCACCGACGCAGTCGATGGTGAAAAGGCGTCTGAGCCCACTGTTTC
TTTTGCCGCCGATAAGGATGAGAAGAAGGACGAGGATAAAAAAGAGGATT
CCGCTGCCGATGGGGAGGACACCAAAAAAGAGAGCAGCGAAGCTGTTCTA
CCTGCTGTCGAGAATGGCTCCGAGGAGGTCACCAACGGTGACTCAACAGA
TGCTCCCGCCATTGAGGCTGTAAAGCGGAAGGTGGATGAGGCTGCAGCCA
AGGCAGATGAGGCCGTCGCCACGCCGGAGAAAAAGGCTAAGCTTGATGAG
GCCAGCACAAAGGATGAGGTTCAGAATGGGGCCGAGGCTAGCGAAGTGGC
CGCCTAAGGGAATCGCCCGCGGAGCAGCAAACTCAGTAATCTACTTATTA
AATACTTACTAACACAAAAAAAAAAAAAAAAAA

LD21289.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:33:17
Subject Length Description Subject Range Query Range Score Percent Strand
Df31-RA 1875 Df31-RA 68..889 1..822 4110 100 Plus
Df31-RF 1895 Df31-RF 68..889 1..822 4110 100 Plus
Df31-RB 1597 Df31-RB 45..745 122..822 3505 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 21626344..21626711 599..232 1840 100 Minus
chr2L 23010047 chr2L 21628171..21628401 231..1 1155 100 Minus
chr2L 23010047 chr2L 21626035..21626254 815..596 1100 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:08:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:45:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21627842..21628209 599..232 1840 100 Minus
2L 23513712 2L 21629667..21629897 231..1 1155 100 Minus
2L 23513712 2L 21627535..21627761 822..596 1135 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21627842..21628209 599..232 1840 100 Minus
2L 23513712 2L 21629667..21629897 231..1 1155 100 Minus
2L 23513712 2L 21627535..21627761 822..596 1135 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:45:10 has no hits.

LD21289.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:46:16 Download gff for LD21289.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 21626035..21626250 600..815 100 <- Minus
chr2L 21626344..21626711 232..599 100 <- Minus
chr2L 21628171..21628401 1..231 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:55:42 Download gff for LD21289.complete
Subject Subject Range Query Range Percent Splice Strand
Df31-RB 1..552 206..757 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:22:42 Download gff for LD21289.complete
Subject Subject Range Query Range Percent Splice Strand
Df31-RB 1..552 206..757 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:16:44 Download gff for LD21289.complete
Subject Subject Range Query Range Percent Splice Strand
Df31-RF 1..552 206..757 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:55:23 Download gff for LD21289.complete
Subject Subject Range Query Range Percent Splice Strand
Df31-RB 1..552 206..757 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:49:20 Download gff for LD21289.complete
Subject Subject Range Query Range Percent Splice Strand
Df31-RF 1..552 206..757 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:20:05 Download gff for LD21289.complete
Subject Subject Range Query Range Percent Splice Strand
Df31-RA 32..846 1..815 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:22:42 Download gff for LD21289.complete
Subject Subject Range Query Range Percent Splice Strand
Df31-RA 32..846 1..815 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:16:44 Download gff for LD21289.complete
Subject Subject Range Query Range Percent Splice Strand
Df31-RF 36..850 1..815 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:55:23 Download gff for LD21289.complete
Subject Subject Range Query Range Percent Splice Strand
Df31-RA 32..846 1..815 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:49:20 Download gff for LD21289.complete
Subject Subject Range Query Range Percent Splice Strand
Df31-RF 36..850 1..815 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:46:16 Download gff for LD21289.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21627542..21627757 600..815 100 <- Minus
2L 21627842..21628209 232..599 100 <- Minus
2L 21629667..21629897 1..231 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:46:16 Download gff for LD21289.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21627542..21627757 600..815 100 <- Minus
2L 21627842..21628209 232..599 100 <- Minus
2L 21629667..21629897 1..231 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:46:16 Download gff for LD21289.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21627542..21627757 600..815 100 <- Minus
2L 21627842..21628209 232..599 100 <- Minus
2L 21629667..21629897 1..231 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:16:44 Download gff for LD21289.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21627542..21627757 600..815 100 <- Minus
arm_2L 21627842..21628209 232..599 100 <- Minus
arm_2L 21629667..21629897 1..231 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:33:07 Download gff for LD21289.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21627542..21627757 600..815 100 <- Minus
2L 21627842..21628209 232..599 100 <- Minus
2L 21629667..21629897 1..231 100   Minus

LD21289.hyp Sequence

Translation from 205 to 756

> LD21289.hyp
MADVAEQKNETPVVEKVAAEEVDAVKKDAVAAEEVAAEKASITENGGAEE
ESVAKENGAADSSATEPTDAVDGEKASEPTVSFAADKDEKKDEDKKEDSA
ADGEDTKKESSEAVLPAVENGSEEVTNGDSTDAPAIEAVKRKVDEAAAKA
DEAVATPEKKAKLDEASTKDEVQNGAEASEVAA*

LD21289.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
Df31-PB 183 CG2207-PB 1..183 1..183 886 100 Plus
Df31-PA 183 CG2207-PA 1..183 1..183 886 100 Plus
Df31-PF 183 CG2207-PF 1..183 1..183 886 100 Plus

LD21289.pep Sequence

Translation from 205 to 756

> LD21289.pep
MADVAEQKNETPVVEKVAAEEVDAVKKDAVAAEEVAAEKASITENGGAEE
ESVAKENGAADSSATEPTDAVDGEKASEPTVSFAADKDEKKDEDKKEDSA
ADGEDTKKESSEAVLPAVENGSEEVTNGDSTDAPAIEAVKRKVDEAAAKA
DEAVATPEKKAKLDEASTKDEVQNGAEASEVAA*

LD21289.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:51:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14424-PA 168 GF14424-PA 1..168 1..183 356 72.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:51:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21483-PA 184 GG21483-PA 1..184 1..183 643 84.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:51:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10947-PA 199 GH10947-PA 1..199 1..183 284 53.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:25
Subject Length Description Subject Range Query Range Score Percent Strand
Df31-PB 183 CG2207-PB 1..183 1..183 886 100 Plus
Df31-PA 183 CG2207-PA 1..183 1..183 886 100 Plus
Df31-PF 183 CG2207-PF 1..183 1..183 886 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:51:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12144-PA 180 GI12144-PA 1..180 1..183 340 64.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:51:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25953-PA 182 GL25953-PA 1..182 1..183 412 69.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:51:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15302-PA 182 GA15302-PA 1..182 1..183 407 69.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:51:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16132-PA 183 GM16132-PA 1..183 1..183 684 92.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21634-PA 183 GD21634-PA 1..183 1..183 636 92.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14182-PA 128 GJ14182-PA 1..128 1..183 279 53.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:51:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24871-PA 187 GK24871-PA 1..187 1..183 246 62.4 Plus
Dwil\GK23384-PA 187 GK23384-PA 1..187 1..183 244 61.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:51:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Df31-PA 184 GE12984-PA 1..184 1..183 606 85.4 Plus