Clone LD21404 Report

Search the DGRC for LD21404

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:214
Well:4
Vector:pOT2
Associated Gene/TranscriptmRpL16-RA
Protein status:LD21404.pep: gold
Preliminary Size:1300
Sequenced Size:848

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3109 2001-01-01 Release 2 assignment
CG3109 2001-09-19 Blastp of sequenced clone
CG3109 2003-01-01 Sim4 clustering to Release 3
mRpL16 2008-04-29 Release 5.5 accounting
mRpL16 2008-08-15 Release 5.9 accounting
mRpL16 2008-12-18 5.12 accounting

Clone Sequence Records

LD21404.complete Sequence

848 bp (848 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058507

> LD21404.complete
CACAATACAATTTTATAAATAAGTAATATATTTTGACATAAACTCACCAT
GCTCTCATTAAAGTTAGTCTCCCAGCTCTTTAAGCAAAGCCTTGCGTCGG
GCAACATGGCAATTGTCAACACAGCCGGTCTTAAGTATTTCGCTCCGCCT
ATTAAATACCAGAATGTGGAGCAGCCGGAGAGACCCAAGCTGAGGGTCAT
TGAGCGCCAGCCCCAGCTGCCGCCAAACATCCGTCCGCCAAAGATGCAGA
AGCGCCTGCGATACATGCGCGGTCCGGAGATGGTGCACAACACGCTGCTC
CATAAGCAGTACGCAATCGTGGCCACTGGCGGAGGGCGCCTGCGCTGGGG
CCACTACGAAATGATGCGTTTGACCATCGGACGCAAGATGAACGTCAACA
CTATGTTCGCCACATGGCGCGTTCCCGCACCCTGGCAGCCGATCACTAAG
AAGGGCCAGGGCCAACGGATGGGCGGCGGAAAGGGAGCCATCGACCACTA
CGTGACCCCCATCAAGGCCGGTCGCGTCATTGTCGAGATAGCCGGCAAGT
GCGAGTTCGTTGAGGTCAAGCAGTTCCTGCAGCAGGTGGCCAACCAGCTG
CCCTTCCAGGCCACCGTCGTTTCCCAGGAGATGCTCGACGAACAGCGCGT
CGCCGAGGAGGAACAGACCCGCCAGAATGAGAACCCCTTTACCATGAAGT
ACGTGATCCAGAACAACCTCAGCGGCTGCCACCGTTGGCTCTCGCCCGTG
GACCACAAGTGGTTCGGCAAGCACCTGTAGATGTATAGCTTCAATTAATA
AAGCCATCCTTCGTTAATCTGTTACGAAAAAAAAAAAAAAAAAAAAAA

LD21404.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL16-RA 1008 mRpL16-RA 68..896 1..829 4145 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1784456..1785118 164..826 3315 100 Plus
chrX 22417052 chrX 1784142..1784238 1..97 485 100 Plus
chrX 22417052 chrX 1784321..1784386 98..163 330 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:08:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1890613..1891278 164..829 3330 100 Plus
X 23542271 X 1890299..1890395 1..97 485 100 Plus
X 23542271 X 1890478..1890543 98..163 330 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:43:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1898711..1899376 164..829 3330 100 Plus
X 23527363 X 1898397..1898493 1..97 485 100 Plus
X 23527363 X 1898576..1898641 98..163 330 100 Plus
Blast to na_te.dros performed 2019-03-15 14:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Uvir 6564 Dvir\Uvir VIRUVIR 6564bp 129..167 44..6 114 76.9 Minus

LD21404.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:50:26 Download gff for LD21404.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1784142..1784238 1..97 100 -> Plus
chrX 1784321..1784386 98..163 100 -> Plus
chrX 1784456..1785118 164..826 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:56:00 Download gff for LD21404.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL16-RA 1..732 49..780 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:04:12 Download gff for LD21404.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL16-RA 1..732 49..780 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:43:18 Download gff for LD21404.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL16-RA 1..732 49..780 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:34:49 Download gff for LD21404.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL16-RA 1..732 49..780 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:09:31 Download gff for LD21404.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL16-RA 1..732 49..780 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:53:07 Download gff for LD21404.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL16-RA 1..826 1..826 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:04:12 Download gff for LD21404.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL16-RA 1..826 1..826 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:43:18 Download gff for LD21404.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL16-RA 44..869 1..826 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:34:49 Download gff for LD21404.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL16-RA 1..826 1..826 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:09:31 Download gff for LD21404.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL16-RA 44..869 1..826 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:50:26 Download gff for LD21404.complete
Subject Subject Range Query Range Percent Splice Strand
X 1890299..1890395 1..97 100 -> Plus
X 1890478..1890543 98..163 100 -> Plus
X 1890613..1891275 164..826 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:50:26 Download gff for LD21404.complete
Subject Subject Range Query Range Percent Splice Strand
X 1890299..1890395 1..97 100 -> Plus
X 1890478..1890543 98..163 100 -> Plus
X 1890613..1891275 164..826 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:50:26 Download gff for LD21404.complete
Subject Subject Range Query Range Percent Splice Strand
X 1890299..1890395 1..97 100 -> Plus
X 1890478..1890543 98..163 100 -> Plus
X 1890613..1891275 164..826 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:43:18 Download gff for LD21404.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1784332..1784428 1..97 100 -> Plus
arm_X 1784511..1784576 98..163 100 -> Plus
arm_X 1784646..1785308 164..826 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:11:45 Download gff for LD21404.complete
Subject Subject Range Query Range Percent Splice Strand
X 1898397..1898493 1..97 100 -> Plus
X 1898576..1898641 98..163 100 -> Plus
X 1898711..1899373 164..826 100   Plus

LD21404.pep Sequence

Translation from 48 to 779

> LD21404.pep
MLSLKLVSQLFKQSLASGNMAIVNTAGLKYFAPPIKYQNVEQPERPKLRV
IERQPQLPPNIRPPKMQKRLRYMRGPEMVHNTLLHKQYAIVATGGGRLRW
GHYEMMRLTIGRKMNVNTMFATWRVPAPWQPITKKGQGQRMGGGKGAIDH
YVTPIKAGRVIVEIAGKCEFVEVKQFLQQVANQLPFQATVVSQEMLDEQR
VAEEEQTRQNENPFTMKYVIQNNLSGCHRWLSPVDHKWFGKHL*

LD21404.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:46:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19450-PA 243 GF19450-PA 1..242 1..242 1204 89.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:46:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12889-PA 243 GG12889-PA 1..243 1..243 1247 94.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:46:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17672-PA 243 GH17672-PA 1..243 1..243 1117 83.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:17
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL16-PB 243 CG3109-PB 1..243 1..243 1292 100 Plus
mRpL16-PA 243 CG3109-PA 1..243 1..243 1292 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21490-PA 197 GI21490-PA 1..186 1..186 825 81.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18214-PA 140 GL18214-PA 1..138 1..138 621 84.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:46:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16000-PA 243 GA16000-PA 1..243 1..243 1156 86.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:46:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19177-PA 243 GM19177-PA 1..243 1..243 1279 97.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:46:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16576-PA 178 GD16576-PA 1..178 66..243 958 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19031-PA 243 GJ19031-PA 1..243 1..243 1108 82.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:47:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16222-PA 243 GK16222-PA 1..243 1..243 1135 83.1 Plus

LD21404.hyp Sequence

Translation from 48 to 779

> LD21404.hyp
MLSLKLVSQLFKQSLASGNMAIVNTAGLKYFAPPIKYQNVEQPERPKLRV
IERQPQLPPNIRPPKMQKRLRYMRGPEMVHNTLLHKQYAIVATGGGRLRW
GHYEMMRLTIGRKMNVNTMFATWRVPAPWQPITKKGQGQRMGGGKGAIDH
YVTPIKAGRVIVEIAGKCEFVEVKQFLQQVANQLPFQATVVSQEMLDEQR
VAEEEQTRQNENPFTMKYVIQNNLSGCHRWLSPVDHKWFGKHL*

LD21404.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL16-PB 243 CG3109-PB 1..243 1..243 1292 100 Plus
mRpL16-PA 243 CG3109-PA 1..243 1..243 1292 100 Plus