Clone LD21410 Report

Search the DGRC for LD21410

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:214
Well:10
Vector:pOT2
Associated Gene/TranscriptVhaM9.7-c-RA
Protein status:LD21410.pep: gold
Preliminary Size:932
Sequenced Size:823

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11589 2001-01-01 Release 2 assignment
CG11589 2002-11-12 Blastp of sequenced clone
CG11589 2003-01-01 Sim4 clustering to Release 3
VhaM9.7-1 2008-04-29 Release 5.5 accounting
VhaM9.7-1 2008-08-15 Release 5.9 accounting
VhaM9.7-1 2008-12-18 5.12 accounting

Clone Sequence Records

LD21410.complete Sequence

823 bp (823 high quality bases) assembled on 2002-11-12

GenBank Submission: AY069473

> LD21410.complete
GTGCCGATTTAATTTGACGTAAATAAAGGAAAGTGGAGAAAATAAGCAAC
AATCATGGAAGTTTTCCTAACAATCGTCTTCTTCACCATCTTCTGGGCGG
CGGTGGCCAAGTACGGACCCATTCTGTTCACCAAGCAACCGCACGATGAC
CTGGTGCGCTGCATTTTCCTTCTGACCGCCGTCGTCTGCTGGCTTTTCTG
GCTGTGCTGCTATTTGGCGCAACTGAATCCACTGCTGGGGCCGAAACTCA
ATGGAAACACCATTCGGATCATTGCCTCGTCCTGGGGAAATCCCATCAAG
GAGGGATAAGGAAAGCCCACATAGGAATCTCCCACCTAGCTAATCTTTGG
CGGTTGCTTCTTCCGCGTATTTCCGGATCTTAAGCCACATCACACACAGT
CGGTGAAACCACGGAAGCAGTGGCTTCGCCAAACCCTTTTTGTACTTCAA
TACTGGCAGCAAGTGGACAAGGTTGGGCTACGGCTATCCAAGCCCCAGAT
ACGCCCCACTATTTCCAAACTAACCACATTAACCTCTGGACGTAAACTTT
CACTGTACATTTTGTTGTTGCTTATAGCTCAATATCTCTGATCACCATAT
TCTTTATGTTTACTGCAAAACATAAGCCATGTATTCCACCCAAAAATCCA
ATTATTGCAATTTAATTCTCAACAAACTTGCCACATGAGCGATTTTTGTA
GTCAGATTATTATTTACCTATTTTTCCGTAGTGTAGATAATTTACTAATC
AGTCATTGTATTTGTGATTTAGCTATTGGCAAATATAGAACAATTTTTTC
GTATTAAAAAAAAAAAAAAAAAA

LD21410.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9_7-1-RA 799 VhaM9_7-1-RA 1..799 7..805 3995 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4185404..4186202 805..7 3995 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:09:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4186017..4186816 806..7 4000 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4186017..4186816 806..7 4000 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:54:00 has no hits.

LD21410.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:54:44 Download gff for LD21410.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4185404..4186202 7..805 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:56:02 Download gff for LD21410.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-1-RA 1..255 55..309 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:05:12 Download gff for LD21410.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-c-RA 1..255 55..309 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:05 Download gff for LD21410.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-c-RA 1..255 55..309 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:55:18 Download gff for LD21410.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-1-RA 1..255 55..309 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:38:00 Download gff for LD21410.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-c-RA 1..255 55..309 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:24:39 Download gff for LD21410.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-1-RA 1..799 7..805 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:05:12 Download gff for LD21410.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-c-RA 1..799 7..805 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:05 Download gff for LD21410.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-c-RA 50..848 7..805 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:55:18 Download gff for LD21410.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-1-RA 1..799 7..805 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:38:00 Download gff for LD21410.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-c-RA 50..848 7..805 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:54:44 Download gff for LD21410.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4186018..4186816 7..805 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:54:44 Download gff for LD21410.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4186018..4186816 7..805 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:54:44 Download gff for LD21410.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4186018..4186816 7..805 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:05 Download gff for LD21410.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4186018..4186816 7..805 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:27:40 Download gff for LD21410.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4186018..4186816 7..805 100   Minus

LD21410.pep Sequence

Translation from 54 to 308

> LD21410.pep
MEVFLTIVFFTIFWAAVAKYGPILFTKQPHDDLVRCIFLLTAVVCWLFWL
CCYLAQLNPLLGPKLNGNTIRIIASSWGNPIKEG*

LD21410.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:15:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20059-PA 83 GF20059-PA 1..81 1..81 309 69.1 Plus
Dana\GF20098-PA 85 GF20098-PA 5..85 4..84 241 51.9 Plus
Dana\GF23725-PA 89 GF23725-PA 9..83 8..83 213 51.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:15:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14211-PA 84 GG14211-PA 1..84 1..84 430 96.4 Plus
Dere\GG15212-PA 85 GG15212-PA 3..85 2..84 251 51.8 Plus
Dere\GG16199-PA 89 GG16199-PA 9..83 8..83 202 48.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15937-PA 85 GH15937-PA 3..85 2..84 255 53 Plus
Dgri\GH15548-PA 92 GH15548-PA 4..84 3..83 249 55.6 Plus
Dgri\GH14789-PA 89 GH14789-PA 2..83 1..83 214 49.4 Plus
Dgri\GH19550-PA 88 GH19550-PA 1..80 1..80 146 37.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:18
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9.7-c-PA 84 CG11589-PA 1..84 1..84 461 100 Plus
VhaM9.7-a-PC 85 CG1268-PC 5..85 4..84 264 53.1 Plus
VhaM9.7-a-PB 85 CG1268-PB 5..85 4..84 264 53.1 Plus
VhaM9.7-b-PB 89 CG7625-PB 9..83 8..83 214 48.7 Plus
VhaM9.7-b-PA 89 CG7625-PA 9..83 8..83 214 48.7 Plus
VhaM9.7-d-PA 88 CG14909-PA 1..81 1..81 134 32.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16589-PA 85 GI16589-PA 3..85 2..84 249 51.8 Plus
Dmoj\GI16823-PA 85 GI16823-PA 6..85 5..84 248 57.5 Plus
Dmoj\GI21410-PA 85 GI21410-PA 6..85 5..84 248 57.5 Plus
Dmoj\Tes122-PA 89 GI11843-PA 2..83 1..83 212 47 Plus
Dmoj\GI23846-PA 88 GI23846-PA 1..79 1..79 154 34.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12731-PA 84 GL12731-PA 1..84 1..84 316 69 Plus
Dper\GL12843-PA 85 GL12843-PA 3..85 2..84 241 50.6 Plus
Dper\GL11891-PA 90 GL11891-PA 10..84 8..83 203 50 Plus
Dper\GL24534-PA 88 GL24534-PA 1..79 1..79 145 36.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11084-PA 84 GA11084-PA 1..84 1..84 316 69 Plus
Dpse\GA11753-PA 85 GA11753-PA 3..85 2..84 241 50.6 Plus
Dpse\GA20488-PA 90 GA20488-PA 10..84 8..83 203 50 Plus
Dpse\GA13345-PA 88 GA13345-PA 1..79 1..79 145 36.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14003-PA 84 GM14003-PA 1..84 1..84 433 97.6 Plus
Dsec\GM14641-PA 85 GM14641-PA 3..85 2..84 251 51.8 Plus
Dsec\GM22381-PA 89 GM22381-PA 9..83 8..83 202 48.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13283-PA 84 GD13283-PA 1..84 1..84 427 96.4 Plus
Dsim\GD14971-PA 89 GD14971-PA 9..83 8..83 202 48.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:15:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12841-PA 85 GJ12841-PA 3..85 2..84 249 51.8 Plus
Dvir\GJ12571-PA 85 GJ12571-PA 6..85 5..84 234 50 Plus
Dvir\GJ13542-PA 89 GJ13542-PA 2..83 1..83 219 47 Plus
Dvir\GJ10560-PA 88 GJ10560-PA 6..77 6..77 136 38.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:15:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19005-PA 85 GK19005-PA 3..85 2..84 251 53 Plus
Dwil\GK17834-PA 89 GK17834-PA 3..83 2..83 199 43.9 Plus
Dwil\GK18963-PA 88 GK18963-PA 1..80 1..80 148 37.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:15:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20639-PA 84 GE20639-PA 1..84 1..84 423 95.2 Plus
Dyak\GE21432-PA 85 GE21432-PA 3..85 2..84 251 51.8 Plus
Dyak\GE19771-PA 89 GE19771-PA 9..83 8..83 202 48.7 Plus
Dyak\GE19768-PA 89 GE19768-PA 9..83 8..83 202 48.7 Plus

LD21410.hyp Sequence

Translation from 54 to 308

> LD21410.hyp
MEVFLTIVFFTIFWAAVAKYGPILFTKQPHDDLVRCIFLLTAVVCWLFWL
CCYLAQLNPLLGPKLNGNTIRIIASSWGNPIKEG*

LD21410.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:18:03
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9.7-c-PA 84 CG11589-PA 1..84 1..84 461 100 Plus
VhaM9.7-a-PC 85 CG1268-PC 5..85 4..84 264 53.1 Plus
VhaM9.7-a-PB 85 CG1268-PB 5..85 4..84 264 53.1 Plus
VhaM9.7-b-PB 89 CG7625-PB 9..83 8..83 214 48.7 Plus
VhaM9.7-b-PA 89 CG7625-PA 9..83 8..83 214 48.7 Plus