Clone LD21504 Report

Search the DGRC for LD21504

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:215
Well:4
Vector:pOT2
Associated Gene/TranscriptUblcp1-RA
Protein status:LD21504.pep: gold
Preliminary Size:1182
Sequenced Size:1200

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6697 2000-02-14 Blastp of sequenced clone
CG6697 2001-01-01 Release 2 assignment
CG6697 2003-01-01 Sim4 clustering to Release 3
CG6697 2008-04-29 Release 5.5 accounting
CG6697 2008-08-15 Release 5.9 accounting
CG6697 2008-12-18 5.12 accounting

Clone Sequence Records

LD21504.complete Sequence

1200 bp (1200 high quality bases) assembled on 2000-02-14

GenBank Submission: AF132171

> LD21504.complete
ACAACTCGACTGTTTATATGGTCTTCTAATAAATTAGTTAATATCTTTAA
GGTACACTATTGCAAACCACTTGCTGGATTCTATCCAACAAACATACATT
ACCATATATGGTGTGATAAATTAATAGCGGAATAGAAACCAGCTAAGATG
GAGGTCAAAGAAGTGGTAGTGATTGTAAAATGGAGTGGTAAGGAGTACCC
GGTGGACCTCACCGACCAGGACACCGTGGAAGTGCTGCGTCACGAGATAT
TCCGCAAGACACAGGTGCGTCCGGAACGTCAAAAGCTGCTCAACCTGAAG
TACAAAGGAAAGACAGCAGCCGACAATGTGAAGATCAGCGCTTTGGAGCT
GAAGCCCAACTTTAAGCTTATGATGGTGGGCTCCACAGAGGCCGATATCG
AGGATGCGTGCAGCCTGCCCGATAATATTGGCGAAGTGGTCGACGACTTC
GATGACGCCGATGAACGCGAAGAGTCCGTGGAGCACTCCGCCGTCTATTT
GGCCAAGGTGCAGCGTCGTGTGCGAGACTACAAGATCAAGGAGTTAGCGC
CGCCGCGTGAGGGCAAGAAGCTGCTTGTCCTGGACATAGACTATACCCTA
TTCGATCACCGATCGCCTGCTGAAACAGGCACGGAGCTAATGCGTCCGTA
TCTGCACGAGTTTCTGACTTCCGCCTACGAGGACTACGACATTGTCATCT
GGTCCGCCACCAGCATGCGCTGGATCGAGGAAAAGATGCGCCTGCTGGGC
GTGGCCAGTAACGATAACTACAAGGTGATGTTCTATCTGGACTCCACCGC
CATGATATCAGTTCATGTGCCGGAGCGCGGTGTGGTGGACGTAAAGCCGC
TTGGTGTAATCTGGGCCCTGTACAAGCAATACAACTCGAGCAACACTATC
ATGTTTGATGACATCCGTCGCAACTTCCTTATGAACCCAAAGTCCGGCCT
AAAGATCCGCCCATTCCGTCAGGCTCATCTCAACCGTGGCACGGACACCG
AGCTGCTCAAGTTGTCCGACTATTTGCGCAAAATCGCTCACCACTGCCCG
GATTTCAATTCGCTAAACCATCGCAAGTGGGAGCACTACCATCCCAAGAA
GAACTCCTGAACTTATCCTCGGTTGCAAACATTTGTTAGATTTATGTTAG
ATTTATGTTTATTAAATTAAGATGCATTTTATAAAAAAAAAAAAAAAAAA

LD21504.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG6697-RA 1336 CG6697-RA 57..1239 1..1183 5915 100 Plus
CG6697.b 1196 CG6697.b 19..1196 1..1183 5815 99.5 Plus
CG6697.a 1158 CG6697.a 277..1158 302..1183 4395 99.8 Plus
CG6697.a 1158 CG6697.a 19..283 1..265 1325 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:07:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18885290..18886166 306..1182 4385 100 Plus
chr3R 27901430 chr3R 18884928..18885235 1..308 1540 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:09:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:07:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23061875..23062752 306..1183 4390 100 Plus
3R 32079331 3R 23061513..23061820 1..308 1540 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:03:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22802706..22803583 306..1183 4390 100 Plus
3R 31820162 3R 22802344..22802651 1..308 1540 100 Plus
Blast to na_te.dros performed on 2019-03-16 10:07:25 has no hits.

LD21504.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:08:25 Download gff for LD21504.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18884928..18885234 1..307 100 -> Plus
chr3R 18885292..18886166 308..1182 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:56:15 Download gff for LD21504.complete
Subject Subject Range Query Range Percent Splice Strand
CG6697-RA 1..963 148..1110 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:35:16 Download gff for LD21504.complete
Subject Subject Range Query Range Percent Splice Strand
CG6697-RA 1..963 148..1110 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:30:40 Download gff for LD21504.complete
Subject Subject Range Query Range Percent Splice Strand
Ublcp1-RA 1..963 148..1110 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:11:13 Download gff for LD21504.complete
Subject Subject Range Query Range Percent Splice Strand
CG6697-RA 1..963 148..1110 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:56:10 Download gff for LD21504.complete
Subject Subject Range Query Range Percent Splice Strand
Ublcp1-RA 1..963 148..1110 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:38:13 Download gff for LD21504.complete
Subject Subject Range Query Range Percent Splice Strand
CG6697-RA 19..1200 1..1182 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:35:16 Download gff for LD21504.complete
Subject Subject Range Query Range Percent Splice Strand
CG6697-RA 19..1200 1..1182 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:30:40 Download gff for LD21504.complete
Subject Subject Range Query Range Percent Splice Strand
Ublcp1-RA 21..1202 1..1182 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:11:13 Download gff for LD21504.complete
Subject Subject Range Query Range Percent Splice Strand
CG6697-RA 19..1200 1..1182 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:56:10 Download gff for LD21504.complete
Subject Subject Range Query Range Percent Splice Strand
Ublcp1-RA 21..1202 1..1182 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:08:25 Download gff for LD21504.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23061513..23061819 1..307 100 -> Plus
3R 23061877..23062751 308..1182 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:08:25 Download gff for LD21504.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23061513..23061819 1..307 100 -> Plus
3R 23061877..23062751 308..1182 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:08:25 Download gff for LD21504.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23061513..23061819 1..307 100 -> Plus
3R 23061877..23062751 308..1182 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:30:40 Download gff for LD21504.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18887599..18888473 308..1182 100   Plus
arm_3R 18887235..18887541 1..307 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:47:31 Download gff for LD21504.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22802344..22802650 1..307 100 -> Plus
3R 22802708..22803582 308..1182 100   Plus

LD21504.hyp Sequence

Translation from 147 to 1109

> LD21504.hyp
MEVKEVVVIVKWSGKEYPVDLTDQDTVEVLRHEIFRKTQVRPERQKLLNL
KYKGKTAADNVKISALELKPNFKLMMVGSTEADIEDACSLPDNIGEVVDD
FDDADEREESVEHSAVYLAKVQRRVRDYKIKELAPPREGKKLLVLDIDYT
LFDHRSPAETGTELMRPYLHEFLTSAYEDYDIVIWSATSMRWIEEKMRLL
GVASNDNYKVMFYLDSTAMISVHVPERGVVDVKPLGVIWALYKQYNSSNT
IMFDDIRRNFLMNPKSGLKIRPFRQAHLNRGTDTELLKLSDYLRKIAHHC
PDFNSLNHRKWEHYHPKKNS*

LD21504.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:01:13
Subject Length Description Subject Range Query Range Score Percent Strand
Ublcp1-PA 320 CG6697-PA 1..320 1..320 1678 100 Plus

LD21504.pep Sequence

Translation from 147 to 1109

> LD21504.pep
MEVKEVVVIVKWSGKEYPVDLTDQDTVEVLRHEIFRKTQVRPERQKLLNL
KYKGKTAADNVKISALELKPNFKLMMVGSTEADIEDACSLPDNIGEVVDD
FDDADEREESVEHSAVYLAKVQRRVRDYKIKELAPPREGKKLLVLDIDYT
LFDHRSPAETGTELMRPYLHEFLTSAYEDYDIVIWSATSMRWIEEKMRLL
GVASNDNYKVMFYLDSTAMISVHVPERGVVDVKPLGVIWALYKQYNSSNT
IMFDDIRRNFLMNPKSGLKIRPFRQAHLNRGTDTELLKLSDYLRKIAHHC
PDFNSLNHRKWEHYHPKKNS*

LD21504.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:51:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16974-PA 321 GF16974-PA 3..321 2..320 1596 94.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11183-PA 320 GG11183-PA 1..320 1..320 1683 98.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:51:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23676-PA 322 GH23676-PA 3..322 2..320 1521 87.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
Ublcp1-PA 320 CG6697-PA 1..320 1..320 1678 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:51:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23016-PA 322 GI23016-PA 3..322 2..320 1501 85.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:51:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13660-PA 321 GL13660-PA 3..321 2..320 1539 90.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19790-PA 321 GA19790-PA 3..321 2..320 1538 90.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26482-PA 320 GM26482-PA 1..320 1..320 1707 99.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:51:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24610-PA 322 GJ24610-PA 3..322 2..320 1492 86.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:51:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14409-PA 320 GK14409-PA 12..320 12..319 1403 88.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:51:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10350-PA 320 GE10350-PA 1..320 1..320 1689 98.4 Plus