Clone LD21545 Report

Search the DGRC for LD21545

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:215
Well:45
Vector:pOT2
Associated Gene/TranscriptCG12129-RA
Protein status:LD21545.pep: gold
Preliminary Size:1300
Sequenced Size:1270

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12129 2002-05-31 Blastp of sequenced clone
CG12129 2003-01-01 Sim4 clustering to Release 3
CG12129 2008-04-29 Release 5.5 accounting
CG12129 2008-08-15 Release 5.9 accounting
CG12129 2008-12-18 5.12 accounting

Clone Sequence Records

LD21545.complete Sequence

1270 bp (1270 high quality bases) assembled on 2002-05-31

GenBank Submission: AY118329

> LD21545.complete
TGCATAGTAGTCATTCCCGGCTTGTCTATCATTTAATGAAGTACATTTGA
TTTTGGATATCGCCGTAATTATAAAAGAGTCCTAAATATTTTTGATCACC
ATGAGCCGCGAAGTGTTATCACCTCCTGTCCAAAAGATGAGCCAGAATCG
GCGCTATAGAGTCAACGTTGTTCACGACGACTTCGGTGGCGACAAGTGGA
ATGGTCAAAACCAACGGAATAAACTAGAGTACAAAGCCTACGAAGAGCCG
GATCTTTATGGTGATGATGATGATGACGAGGACGATGCGGTTGTCAAATG
TATTAAGGAGTCAGCAAATGGCGATTTTAGTCTTTCCATTCATGTGTCCA
AATCATTTTACGGTGGACTAATTGGCATGAAAGGATCTACGAAGCGCCGC
ATAGAGGAAGAGACCCGTACAGAGATCTTTGTTCCGCGTCCGAACGATAG
GTCAAACGAAGTGACTATCAAGGCCAAGCAACGCAGTCAAGTATGCGCTG
CACTGCGACAAATCCACCATCTTGTAGCCTCTTTACGAAAAAAAATGAAA
CCGACACACTTTTTGGCCGTGGCTCTAAACTCTGGAGAAGTCAAGGAGCG
TTTTATGGAACTAAAGAAATGCATTTTGGAGGCCGAGTTGCCAGGCATCG
ATAAGGAGCTTTTCACTCCGGAGTGCTGCATTCATCTTACCTTAGGCGTC
TATGTGCTGCTAGATGACATTGAACGCCAAGAAGCCCTGAAGAATCTGGA
ATCATGTCGTCGTTTACTGGATGGCCTTAAAATACCTTTCCAAATTAAAG
TTAAGGGCCTGGAGATTATGAACGACGATCCAAGCTCCACTCGCATTCTG
TATGCCCGCATCGAGTCTCCGGATCTGCAAAAGTTTGCGGATCAGTGTCT
GGCCCACTTTCAGACTACAGCACTGTGCGCTACAGACAATATTGAACGTG
AATCCATTAAACTGCACATGACGGTGATGAACAACCGCTACCGCAATAAG
GCAAATAAATCTGGTAACAGCTTTGACGCTCGCGAGATCCTCAAGCGCTT
TGGAGACTTCGATTTCGGAGTAGCCCAGTGCCAGGCTGTACATCTGTGCG
TATTGAATTCGCGCTCCGAGGATGAGTTCTATAAGATAAGCGGTAGTCTC
GAATTCTAAGAAGAATTGAAATAGAGCTTTATTTAAGTTTTTAATAAGAA
CATTTAAAAATGTCTTTTAACAAATAAAAGCCTAGCTAACGGAAAAAAAA
AAAAAAAAAAAAAAAAAAAA

LD21545.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:55:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG12129-RA 1401 CG12129-RA 26..1269 1..1244 6220 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5921594..5922221 615..1242 3110 99.7 Plus
chr2R 21145070 chr2R 5921280..5921544 352..616 1325 100 Plus
chr2R 21145070 chr2R 5920824..5921074 1..251 1240 99.6 Plus
chr2R 21145070 chr2R 5921126..5921226 251..351 505 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:09:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:04:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10034071..10034700 615..1244 3150 100 Plus
2R 25286936 2R 10033757..10034021 352..616 1325 100 Plus
2R 25286936 2R 10033301..10033551 1..251 1255 100 Plus
2R 25286936 2R 10033603..10033703 251..351 505 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:28:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10035270..10035899 615..1244 3150 100 Plus
2R 25260384 2R 10034956..10035220 352..616 1325 100 Plus
2R 25260384 2R 10034500..10034750 1..251 1255 100 Plus
2R 25260384 2R 10034802..10034902 251..351 505 100 Plus
Blast to na_te.dros performed 2019-03-15 16:04:13
Subject Length Description Subject Range Query Range Score Percent Strand
G3 4605 G3 G3 4605bp 1450..1526 118..195 117 62.8 Plus

LD21545.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:05:01 Download gff for LD21545.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5921280..5921544 352..616 100 -> Plus
chr2R 5920824..5921074 1..251 99 -> Plus
chr2R 5921127..5921226 252..351 100 -> Plus
chr2R 5921596..5922221 617..1242 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:56:20 Download gff for LD21545.complete
Subject Subject Range Query Range Percent Splice Strand
CG12129-RA 1..1059 101..1159 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:34:18 Download gff for LD21545.complete
Subject Subject Range Query Range Percent Splice Strand
CG12129-RA 1..1059 101..1159 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:51:43 Download gff for LD21545.complete
Subject Subject Range Query Range Percent Splice Strand
CG12129-RA 1..1059 101..1159 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:25:54 Download gff for LD21545.complete
Subject Subject Range Query Range Percent Splice Strand
CG12129-RA 1..1059 101..1159 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:25:48 Download gff for LD21545.complete
Subject Subject Range Query Range Percent Splice Strand
CG12129-RA 1..1059 101..1159 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:05:28 Download gff for LD21545.complete
Subject Subject Range Query Range Percent Splice Strand
CG12129-RA 8..1249 1..1242 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:34:18 Download gff for LD21545.complete
Subject Subject Range Query Range Percent Splice Strand
CG12129-RA 8..1249 1..1242 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:51:43 Download gff for LD21545.complete
Subject Subject Range Query Range Percent Splice Strand
CG12129-RA 1..1239 4..1242 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:25:55 Download gff for LD21545.complete
Subject Subject Range Query Range Percent Splice Strand
CG12129-RA 8..1249 1..1242 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:25:48 Download gff for LD21545.complete
Subject Subject Range Query Range Percent Splice Strand
CG12129-RA 1..1239 4..1242 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:05:01 Download gff for LD21545.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10033301..10033551 1..251 100 -> Plus
2R 10033604..10033703 252..351 100 -> Plus
2R 10033757..10034021 352..616 100 -> Plus
2R 10034073..10034698 617..1242 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:05:01 Download gff for LD21545.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10033301..10033551 1..251 100 -> Plus
2R 10033604..10033703 252..351 100 -> Plus
2R 10033757..10034021 352..616 100 -> Plus
2R 10034073..10034698 617..1242 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:05:01 Download gff for LD21545.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10033301..10033551 1..251 100 -> Plus
2R 10033604..10033703 252..351 100 -> Plus
2R 10033757..10034021 352..616 100 -> Plus
2R 10034073..10034698 617..1242 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:51:43 Download gff for LD21545.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5920806..5921056 1..251 100 -> Plus
arm_2R 5921109..5921208 252..351 100 -> Plus
arm_2R 5921262..5921526 352..616 100 -> Plus
arm_2R 5921578..5922203 617..1242 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:58:19 Download gff for LD21545.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10034500..10034750 1..251 100 -> Plus
2R 10034803..10034902 252..351 100 -> Plus
2R 10034956..10035220 352..616 100 -> Plus
2R 10035272..10035897 617..1242 100   Plus

LD21545.pep Sequence

Translation from 100 to 1158

> LD21545.pep
MSREVLSPPVQKMSQNRRYRVNVVHDDFGGDKWNGQNQRNKLEYKAYEEP
DLYGDDDDDEDDAVVKCIKESANGDFSLSIHVSKSFYGGLIGMKGSTKRR
IEEETRTEIFVPRPNDRSNEVTIKAKQRSQVCAALRQIHHLVASLRKKMK
PTHFLAVALNSGEVKERFMELKKCILEAELPGIDKELFTPECCIHLTLGV
YVLLDDIERQEALKNLESCRRLLDGLKIPFQIKVKGLEIMNDDPSSTRIL
YARIESPDLQKFADQCLAHFQTTALCATDNIERESIKLHMTVMNNRYRNK
ANKSGNSFDAREILKRFGDFDFGVAQCQAVHLCVLNSRSEDEFYKISGSL
EF*

LD21545.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12010-PA 351 GF12010-PA 1..351 1..352 1325 70.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24129-PA 351 GG24129-PA 1..351 1..352 1536 83.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20290-PA 351 GH20290-PA 1..351 1..352 1187 63.7 Plus
Dgri\GH25238-PA 265 GH25238-PA 1..186 1..190 588 59.5 Plus
Dgri\GH25238-PA 265 GH25238-PA 181..265 271..352 246 61.2 Plus
Dgri\GH17982-PA 83 GH17982-PA 1..83 273..352 242 61.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG12129-PA 352 CG12129-PA 1..352 1..352 1833 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19460-PA 352 GI19460-PA 1..352 1..352 1225 65 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11512-PA 351 GL11512-PA 1..351 1..352 1337 73 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11423-PA 351 GA11423-PA 1..351 1..352 1329 72.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21176-PA 352 GM21176-PA 1..352 1..352 1665 91.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10708-PA 335 GD10708-PA 1..331 1..331 1590 91.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21211-PA 351 GJ21211-PA 1..351 1..352 1238 65.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21956-PA 353 GK21956-PA 1..353 1..352 1231 66.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19327-PA 351 GE19327-PA 1..351 1..352 1557 84.4 Plus

LD21545.hyp Sequence

Translation from 100 to 1158

> LD21545.hyp
MSREVLSPPVQKMSQNRRYRVNVVHDDFGGDKWNGQNQRNKLEYKAYEEP
DLYGDDDDDEDDAVVKCIKESANGDFSLSIHVSKSFYGGLIGMKGSTKRR
IEEETRTEIFVPRPNDRSNEVTIKAKQRSQVCAALRQIHHLVASLRKKMK
PTHFLAVALNSGEVKERFMELKKCILEAELPGIDKELFTPECCIHLTLGV
YVLLDDIERQEALKNLESCRRLLDGLKIPFQIKVKGLEIMNDDPSSTRIL
YARIESPDLQKFADQCLAHFQTTALCATDNIERESIKLHMTVMNNRYRNK
ANKSGNSFDAREILKRFGDFDFGVAQCQAVHLCVLNSRSEDEFYKISGSL
EF*

LD21545.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:47:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG12129-PA 352 CG12129-PA 1..352 1..352 1833 100 Plus