Clone LD21576 Report

Search the DGRC for LD21576

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:215
Well:76
Vector:pOT2
Associated Gene/TranscriptNap1-RA
Protein status:LD21576.pep: gold
Preliminary Size:1300
Sequenced Size:1326

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5330 2001-01-01 Release 2 assignment
CG5330 2002-07-13 Blastp of sequenced clone
CG5330 2003-01-01 Sim4 clustering to Release 3
Nap1 2008-04-29 Release 5.5 accounting
Nap1 2008-08-15 Release 5.9 accounting
Nap1 2008-12-18 5.12 accounting

Clone Sequence Records

LD21576.complete Sequence

1326 bp (1326 high quality bases) assembled on 2002-07-13

GenBank Submission: BT001479

> LD21576.complete
GGCGGTGCTCATCGTGCGTCTGTTCTAACCGAAGTGAGATCAGCATTTAT
TGAACAATGGACGCCCCAGCCGAAGGACACGTTGACCCCGAGTCCTGCAA
CGAAATCGAGGACGAGAAGTCCGGCTCGGACTGCCAGTCGATGCCCGCCT
ACATGAACTCGGTCATGCGGCGACAGTATCTGCAGCAAATGGTCAAGATG
CTGCCGGCTCCAGTGCAGAATCGGATTGTGTTCCTGAAAAACCTACAGCT
GCAGCACCTGAATATCGAGGCCCAGTTCTTTGAGGACGTCTACAAGCTGG
AGCAGAAGTACCAGGTGCAGTACCAGCCGTTGTTCGATAAGCGCAGGGAG
ATCATCGAGGGCAAGGTGGACCCCGCCGAGGAGAAGCCCCAGTGGAAGGA
ACCGGAGTCGTCGACCGACAACGAGGCCGATGCCGAGCACTTCCGCGAGG
CCCTGAGCAGTTTGAAAAGTATTCCCAAGGATGCCAAGGGCATTCCCGGC
TTCTGGCTGACGGTGTTCCGCAACACGGCCATAATGTCTGAGATGGTGCA
GCCGCACGACGAGCCCGCCATCCGCAAGCTAATCGATATTTCCATCAAGT
ACGACAACGGGCATTCGTACACCTTGGAGTTTCACTTCGACAAGAACGAG
TACTTCTCCAACTCAGTTCTCACAAAGCAGTACGTTTTGAAGTCCACCGT
GGATCCCAACGATCCGTTCGCATTTGAAGGCCCAGAGATCTACAAGTGCA
CGGGGTGCACCATTAACTGGGAGAAGAAGATGAACCTTACTGTGAAGACC
ATCCGCAAGAAGCAGAAGCACAAGGAGCGCGGCGCAGTGCGCACCATTGT
GAAGCAGGTTCCGACGGATTCCTTCTTCAATTTCTTCAGCCCACCAGAGG
TCCCGAGCGACCAGGAGGAAGTCGACGACGACTCCCAGCAGATCCTGGCC
ACCGACTTCGAAATTGGTCACTTCTTGCGCGCCAGAATTATTCCAAAAGC
AGTGCTTTACTACACTGGCGACATCGTCGACGATGAGGACGATGAGGACG
AAGAGGAGTATGACGAGAACGAGGAGGATGAGTACGACGACGACGATGCA
CCGCCACCAAAGGGCCCCAAATCAGCCGGTATCAAGAAGCAGTCGCCCAA
CGACTGCCCGAATCAGTAGGTTGATGTGGCTGGATTACACATGTGTAATG
TATATACATAATTCAAATTTGATTTGAAATATATTTTTGGTGAATAAAAA
TAAAAACAACAATTACAAACGATATGAGCTGAACTCGAATAAACCTACAT
GATATTAGAAAAAAAAAAAAAAAAAA

LD21576.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:43:48
Subject Length Description Subject Range Query Range Score Percent Strand
Nap1-RA 1503 Nap1-RA 151..1460 1..1310 6550 100 Plus
Nap1.a 1310 Nap1.a 27..1302 35..1310 6380 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19792103..19792571 611..143 2345 100 Minus
chr2R 21145070 chr2R 19791218..19791588 1308..938 1855 100 Minus
chr2R 21145070 chr2R 19791648..19791837 941..752 950 100 Minus
chr2R 21145070 chr2R 19791898..19792040 753..611 700 99.3 Minus
chr2R 21145070 chr2R 19792657..19792767 143..33 555 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:09:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23906060..23906528 611..143 2345 100 Minus
2R 25286936 2R 23905173..23905545 1310..938 1865 100 Minus
2R 25286936 2R 23905605..23905794 941..752 950 100 Minus
2R 25286936 2R 23905855..23905997 753..611 715 100 Minus
2R 25286936 2R 23906614..23906724 143..33 555 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23907259..23907727 611..143 2345 100 Minus
2R 25260384 2R 23906372..23906744 1310..938 1865 100 Minus
2R 25260384 2R 23906804..23906993 941..752 950 100 Minus
2R 25260384 2R 23907054..23907196 753..611 715 100 Minus
2R 25260384 2R 23907813..23907923 143..33 555 100 Minus
2R 25260384 2R 23908407..23908440 34..1 170 100 Minus
Blast to na_te.dros performed 2019-03-16 04:00:51
Subject Length Description Subject Range Query Range Score Percent Strand
McClintock 6450 McClintock McCLINTOCK 6450bp 1119..1205 1215..1302 113 60.2 Plus

LD21576.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:01:47 Download gff for LD21576.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19791899..19792039 612..752 99 <- Minus
chr2R 19791218..19791427 1099..1308 100 == Minus
chr2R 19791510..19791584 942..1016 100 <- Minus
chr2R 19791648..19791836 753..941 100 <- Minus
chr2R 19792103..19792571 143..611 100 <- Minus
chr2R 19792658..19792765 35..142 100 <- Minus
chr2R 19793251..19793284 1..34 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:56:24 Download gff for LD21576.complete
Subject Subject Range Query Range Percent Splice Strand
Nap1-RA 1..1113 57..1169 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:17:24 Download gff for LD21576.complete
Subject Subject Range Query Range Percent Splice Strand
Nap1-RA 1..1113 57..1169 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:12:21 Download gff for LD21576.complete
Subject Subject Range Query Range Percent Splice Strand
Nap1-RA 1..1113 57..1169 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:08:36 Download gff for LD21576.complete
Subject Subject Range Query Range Percent Splice Strand
Nap1-RA 1..1113 57..1169 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:22:53 Download gff for LD21576.complete
Subject Subject Range Query Range Percent Splice Strand
Nap1-RA 1..1113 57..1169 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:41:46 Download gff for LD21576.complete
Subject Subject Range Query Range Percent Splice Strand
Nap1-RA 74..1381 1..1308 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:17:24 Download gff for LD21576.complete
Subject Subject Range Query Range Percent Splice Strand
Nap1-RA 74..1381 1..1308 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:12:21 Download gff for LD21576.complete
Subject Subject Range Query Range Percent Splice Strand
Nap1-RA 54..1361 1..1308 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:08:36 Download gff for LD21576.complete
Subject Subject Range Query Range Percent Splice Strand
Nap1-RA 74..1381 1..1308 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:22:53 Download gff for LD21576.complete
Subject Subject Range Query Range Percent Splice Strand
Nap1-RA 54..1361 1..1308 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:01:47 Download gff for LD21576.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23905856..23905996 612..752 100 <- Minus
2R 23905175..23905541 942..1308 100 <- Minus
2R 23905605..23905793 753..941 100 <- Minus
2R 23906060..23906528 143..611 100 <- Minus
2R 23906615..23906722 35..142 100 <- Minus
2R 23907208..23907241 1..34 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:01:47 Download gff for LD21576.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23905856..23905996 612..752 100 <- Minus
2R 23905175..23905541 942..1308 100 <- Minus
2R 23905605..23905793 753..941 100 <- Minus
2R 23906060..23906528 143..611 100 <- Minus
2R 23906615..23906722 35..142 100 <- Minus
2R 23907208..23907241 1..34 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:01:47 Download gff for LD21576.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23905856..23905996 612..752 100 <- Minus
2R 23905175..23905541 942..1308 100 <- Minus
2R 23905605..23905793 753..941 100 <- Minus
2R 23906060..23906528 143..611 100 <- Minus
2R 23906615..23906722 35..142 100 <- Minus
2R 23907208..23907241 1..34 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:12:21 Download gff for LD21576.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19792698..19793064 942..1308 100 <- Minus
arm_2R 19793128..19793316 753..941 100 <- Minus
arm_2R 19793379..19793519 612..752 100 <- Minus
arm_2R 19793583..19794051 143..611 100 <- Minus
arm_2R 19794138..19794245 35..142 100 <- Minus
arm_2R 19794731..19794764 1..34 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:40:33 Download gff for LD21576.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23907073..23907213 612..752 100 <- Minus
2R 23906392..23906758 942..1308 100 <- Minus
2R 23906822..23907010 753..941 100 <- Minus
2R 23907277..23907745 143..611 100 <- Minus
2R 23907832..23907939 35..142 100 <- Minus
2R 23908425..23908458 1..34 100   Minus

LD21576.pep Sequence

Translation from 56 to 1168

> LD21576.pep
MDAPAEGHVDPESCNEIEDEKSGSDCQSMPAYMNSVMRRQYLQQMVKMLP
APVQNRIVFLKNLQLQHLNIEAQFFEDVYKLEQKYQVQYQPLFDKRREII
EGKVDPAEEKPQWKEPESSTDNEADAEHFREALSSLKSIPKDAKGIPGFW
LTVFRNTAIMSEMVQPHDEPAIRKLIDISIKYDNGHSYTLEFHFDKNEYF
SNSVLTKQYVLKSTVDPNDPFAFEGPEIYKCTGCTINWEKKMNLTVKTIR
KKQKHKERGAVRTIVKQVPTDSFFNFFSPPEVPSDQEEVDDDSQQILATD
FEIGHFLRARIIPKAVLYYTGDIVDDEDDEDEEEYDENEEDEYDDDDAPP
PKGPKSAGIKKQSPNDCPNQ*

LD21576.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12054-PA 369 GF12054-PA 1..369 1..370 1503 81.4 Plus
Dana\GF22051-PA 365 GF22051-PA 51..343 30..326 636 42.3 Plus
Dana\GF16306-PA 291 GF16306-PA 39..258 60..325 368 32.7 Plus
Dana\GF11410-PA 273 GF11410-PA 56..230 76..319 151 24.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:48:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19979-PA 369 GG19979-PA 1..369 1..370 1704 92.7 Plus
Dere\GG12732-PA 362 GG12732-PA 46..340 30..325 610 41.6 Plus
Dere\GG11578-PA 289 GG11578-PA 36..259 57..325 401 35.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20189-PA 369 GH20189-PA 1..369 1..370 1439 76 Plus
Dgri\GH12416-PA 390 GH12416-PA 45..352 21..330 695 43.8 Plus
Dgri\GH16575-PA 290 GH16575-PA 38..266 60..336 393 34.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
Nap1-PC 370 CG5330-PC 1..370 1..370 1974 100 Plus
Nap1-PB 370 CG5330-PB 1..370 1..370 1974 100 Plus
Nap1-PA 370 CG5330-PA 1..370 1..370 1974 100 Plus
CG3708-PB 362 CG3708-PB 46..340 30..325 602 40.9 Plus
mil-PA 283 CG5017-PA 37..277 60..347 425 33.7 Plus
Set-PA 269 CG4299-PA 42..259 64..353 206 24.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18847-PA 365 GI18847-PA 1..365 1..370 1404 74.1 Plus
Dmoj\Tes129-PA 390 GI15001-PA 56..354 30..330 695 44.4 Plus
Dmoj\GI22030-PA 289 GI22030-PA 39..255 60..325 353 32 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:48:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10917-PA 372 GL10917-PA 1..372 1..370 1538 82.3 Plus
Dper\GL14420-PA 376 GL14420-PA 41..343 20..329 667 41.4 Plus
Dper\GL12969-PA 242 GL12969-PA 6..205 77..325 336 31.9 Plus
Dper\GL13720-PA 270 GL13720-PA 37..237 57..325 294 28.8 Plus
Dper\GL12968-PA 350 GL12968-PA 32..252 60..323 232 26.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18808-PA 372 GA18808-PA 1..372 1..370 1538 82.3 Plus
Dpse\GA17630-PA 376 GA17630-PA 34..343 12..329 663 40.2 Plus
Dpse\GA23030-PA 288 GA23030-PA 27..255 48..325 368 32.9 Plus
Dpse\GA27003-PB 242 GA27003-PB 37..242 57..310 294 30.4 Plus
Dpse\GA23025-PA 332 GA23025-PA 32..252 60..323 220 26.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15492-PA 370 GM15492-PA 1..370 1..370 1931 97.3 Plus
Dsec\GM19012-PA 362 GM19012-PA 46..340 30..325 623 41.3 Plus
Dsec\GM16360-PA 283 GM16360-PA 34..255 57..325 385 33.5 Plus
Dsec\GM11702-PA 164 GM11702-PA 17..136 188..325 290 41.7 Plus
Dsec\GM15493-PA 113 GM15493-PA 21..106 233..361 174 47.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:48:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24995-PA 370 GD24995-PA 1..370 1..370 1937 97.8 Plus
Dsim\GD21354-PA 283 GD21354-PA 37..255 60..325 374 33.1 Plus
Dsim\GD15341-PA 79 GD15341-PA 1..57 268..325 156 51.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:48:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20453-PA 367 GJ20453-PA 1..367 1..370 1446 76.5 Plus
Dvir\GJ15359-PA 399 GJ15359-PA 64..362 30..330 701 45.7 Plus
Dvir\GJ10476-PA 288 GJ10476-PA 39..255 60..325 360 32 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:48:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15855-PA 369 GK15855-PA 1..369 1..370 1397 75.5 Plus
Dwil\GK10174-PA 360 GK10174-PA 42..346 24..330 672 43.9 Plus
Dwil\GK11772-PA 290 GK11772-PA 42..258 60..325 373 32.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Nap1-PA 371 GE11512-PA 1..371 1..370 1734 94.1 Plus
Dyak\GE23767-PA 290 GE23767-PA 37..260 57..325 397 34.9 Plus
Dyak\GE16558-PA 123 GE16558-PA 37..122 11..103 165 40.9 Plus

LD21576.hyp Sequence

Translation from 56 to 1168

> LD21576.hyp
MDAPAEGHVDPESCNEIEDEKSGSDCQSMPAYMNSVMRRQYLQQMVKMLP
APVQNRIVFLKNLQLQHLNIEAQFFEDVYKLEQKYQVQYQPLFDKRREII
EGKVDPAEEKPQWKEPESSTDNEADAEHFREALSSLKSIPKDAKGIPGFW
LTVFRNTAIMSEMVQPHDEPAIRKLIDISIKYDNGHSYTLEFHFDKNEYF
SNSVLTKQYVLKSTVDPNDPFAFEGPEIYKCTGCTINWEKKMNLTVKTIR
KKQKHKERGAVRTIVKQVPTDSFFNFFSPPEVPSDQEEVDDDSQQILATD
FEIGHFLRARIIPKAVLYYTGDIVDDEDDEDEEEYDENEEDEYDDDDAPP
PKGPKSAGIKKQSPNDCPNQ*

LD21576.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
Nap1-PC 370 CG5330-PC 1..370 1..370 1974 100 Plus
Nap1-PB 370 CG5330-PB 1..370 1..370 1974 100 Plus
Nap1-PA 370 CG5330-PA 1..370 1..370 1974 100 Plus
CG3708-PB 362 CG3708-PB 46..340 30..325 602 40.9 Plus
mil-PA 283 CG5017-PA 37..277 60..347 425 33.7 Plus