Clone LD21667 Report

Search the DGRC for LD21667

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:216
Well:67
Vector:pOT2
Associated Gene/Transcriptl(1)G0004-RA
Protein status:LD21667.pep: gold
Preliminary Size:1094
Sequenced Size:944

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11738 2001-01-01 Release 2 assignment
CG11738 2001-10-10 Blastp of sequenced clone
CG11738 2003-01-01 Sim4 clustering to Release 3
l(1)G0004 2008-04-29 Release 5.5 accounting
l(1)G0004 2008-08-15 Release 5.9 accounting
l(1)G0004 2008-12-18 5.12 accounting

Clone Sequence Records

LD21667.complete Sequence

944 bp (944 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061304

> LD21667.complete
CAAAGCAGCTGGATTGAGAAATTATTGGAAACAACGCAGTAAAAGCACAA
CAGATTGCACCATGGAGGCAGAGAACATCAGAGCAGACGCATTCGAGCCG
GCGAAGAGAGCGACGAAGCGCGGAGCCAGCGGAGGCGGGCAGCAGGACGT
GGAGATGCAGGTGGACGAGGCGACCGGCATTGAGGGCCAGGTGCTGGGAT
CTTCGCGAGCATCGGCGCCGCCCAAGGCAAAGCGGGCCAGAAGCGAGCTG
CGCAAGGTATCCGTGCCGCCACACAGGTACTCCTCGCTCAAGGAGCACTG
GATGAAGATCTTTACGCCCGTGGTGGAGCACATGAAGCTGCAGATCCGCT
TCAACATGAAGGCGCGCCAGGTGGAGCTGCGTGTGGGCCCCGAGACGCCG
GACATAGCCAACCTGCAGCGCGGCGCCGACTTCGTGCGCGCCTTTCTCTG
CGGCTTCGAGGTGGACGACGCCCTGGCCCTGCTGCGTCTGGAGGACCTGT
TCGTCGAGTCGTTCGAAATCAAGGACGTGAAGACGCTGCGCGGCGACCAC
CAGTCTCGCGCCATCGGCCGCCTCGCCGGCAAGGGCGGCCGCACCAAATT
CACCATCGAGAACGTGACCAAGACCCGCATCGTGCTAGCCGATAGCAAGA
TCCACATCCTGGGCAGCTACCAGAACATTCAGCTTGCGCGCCGGGCCGTC
TGCAACCTAATCCTCGGCTCGCCGCCCAGCAAGGTGTATGGCAACCTGCG
GGCAGTCGCCTCGCGCCTCTCGGAGCGCATGTGATTGGGAGAGCGGACTG
GAGTGGACTGGACTGGAGTGGAGTTCGACTTGAGAGGGAGTAGTTGCGGT
TTTTTTTTTAGCATTAGCAATAAATAATAAATATAATAACATGTATTCAA
ACATTTACAATATACACAAACACACACAAAAAAAAAAAAAAAAA

LD21667.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:12:51
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0004-RA 951 l(1)G0004-RA 25..951 1..927 4635 100 Plus
Syx16-RA 1448 Syx16-RA 1373..1448 928..853 380 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:43:59
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20256950..20257868 1..920 4490 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:09:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:43:58
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20391475..20392402 1..928 4640 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:36:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20376567..20377494 1..928 4640 100 Plus
Blast to na_te.dros performed 2019-03-16 15:43:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 349..385 869..905 113 78.4 Plus
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 6935..6971 869..905 113 78.4 Plus
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1043..1104 907..850 111 69.4 Minus

LD21667.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:45:00 Download gff for LD21667.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20256950..20257874 1..927 94   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:56:42 Download gff for LD21667.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0004-RA 1..723 62..784 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:52:46 Download gff for LD21667.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0004-RA 1..723 62..784 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:17:31 Download gff for LD21667.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0004-RA 1..723 62..784 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:21:46 Download gff for LD21667.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0004-RA 1..723 62..784 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:47:19 Download gff for LD21667.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0004-RA 1..723 62..784 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:37:43 Download gff for LD21667.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0004-RA 25..951 1..927 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:52:46 Download gff for LD21667.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0004-RA 25..951 1..927 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:17:31 Download gff for LD21667.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0004-RA 29..955 1..927 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:21:46 Download gff for LD21667.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0004-RA 25..951 1..927 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:47:19 Download gff for LD21667.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0004-RA 29..955 1..927 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:45:00 Download gff for LD21667.complete
Subject Subject Range Query Range Percent Splice Strand
X 20391475..20392401 1..927 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:45:00 Download gff for LD21667.complete
Subject Subject Range Query Range Percent Splice Strand
X 20391475..20392401 1..927 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:45:00 Download gff for LD21667.complete
Subject Subject Range Query Range Percent Splice Strand
X 20391475..20392401 1..927 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:17:31 Download gff for LD21667.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20262502..20263428 1..927 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:58:46 Download gff for LD21667.complete
Subject Subject Range Query Range Percent Splice Strand
X 20376567..20377493 1..927 100   Plus

LD21667.hyp Sequence

Translation from 0 to 783

> LD21667.hyp
KAAGLRNYWKQRSKSTTDCTMEAENIRADAFEPAKRATKRGASGGGQQDV
EMQVDEATGIEGQVLGSSRASAPPKAKRARSELRKVSVPPHRYSSLKEHW
MKIFTPVVEHMKLQIRFNMKARQVELRVGPETPDIANLQRGADFVRAFLC
GFEVDDALALLRLEDLFVESFEIKDVKTLRGDHQSRAIGRLAGKGGRTKF
TIENVTKTRIVLADSKIHILGSYQNIQLARRAVCNLILGSPPSKVYGNLR
AVASRLSERM*

LD21667.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:16:16
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0004-PA 240 CG11738-PA 1..240 21..260 1208 100 Plus

LD21667.pep Sequence

Translation from 61 to 783

> LD21667.pep
MEAENIRADAFEPAKRATKRGASGGGQQDVEMQVDEATGIEGQVLGSSRA
SAPPKAKRARSELRKVSVPPHRYSSLKEHWMKIFTPVVEHMKLQIRFNMK
ARQVELRVGPETPDIANLQRGADFVRAFLCGFEVDDALALLRLEDLFVES
FEIKDVKTLRGDHQSRAIGRLAGKGGRTKFTIENVTKTRIVLADSKIHIL
GSYQNIQLARRAVCNLILGSPPSKVYGNLRAVASRLSERM*

LD21667.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:35:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20246-PA 239 GF20246-PA 1..239 1..240 1191 93.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19285-PA 240 GG19285-PA 1..240 1..240 1262 99.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12628-PA 240 GH12628-PA 1..240 1..240 1096 85.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:27
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0004-PA 240 CG11738-PA 1..240 1..240 1208 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:35:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11042-PA 237 GI11042-PA 1..237 1..240 1037 81.2 Plus
Dmoj\GI11041-PA 214 GI11041-PA 4..213 2..218 451 43.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11169-PA 238 GA11169-PA 1..238 1..240 1142 89.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23025-PA 228 GM23025-PA 10..228 11..240 918 80.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:35:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17488-PA 240 GD17488-PA 1..240 1..240 1241 97.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:35:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15820-PA 239 GJ15820-PA 1..239 1..240 1103 86.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:35:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20148-PA 240 GK20148-PA 1..240 1..240 1027 81.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:35:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17874-PA 240 GE17874-PA 1..240 1..240 1254 98.3 Plus