Clone LD21741 Report

Search the DGRC for LD21741

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:217
Well:41
Vector:pOT2
Associated Gene/TranscriptCG5537-RA
Protein status:LD21741.pep: gold
Preliminary Size:2200
Sequenced Size:1114

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5537 2001-01-01 Release 2 assignment
CG5537 2001-11-29 Blastp of sequenced clone
CG5537 2003-01-01 Sim4 clustering to Release 3
CG5537 2008-04-29 Release 5.5 accounting
CG5537 2008-08-15 Release 5.9 accounting
CG5537 2008-12-18 5.12 accounting

Clone Sequence Records

LD21741.complete Sequence

1114 bp (1114 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069484

> LD21741.complete
CAAGCCAAGCACGCGCTAGGAGGACAAAGTGCTACGTACAATTCTTTTAA
TTTATTTATTTTATGTAGCCAGTGATAGCAACCAAATAGCCGAGTCATGC
GCACCGGCTCGCCCAGCAGCAGCGGCTCCCAGTCGGAGGAGGGCAGCAGT
TCCTCAGATCACCAGCAGCCGCAGCAGGAAGCCCAGGAGCAGGAGCAACA
GCTGCACACTCCCACGCATGCACATGCCGCGGTGCCAGCTGCCACATCGG
AGGAGATCCTGGCGGAGTACGGCAGCAACCTGAAGCTACTCGAGTGCAAT
TCCCAGGTGGCCGAACTGCTGACCATATTGCGCGACAAGAACACCACGCG
CAGTGACTTCAAGTTCTATGCCGACCGTCTCATCCGGCTGGTCATCGAGG
AGTCGCTCAACCAACTGCCCTACACCCATTGCGATGTGGAGACGCCCACC
GGTGCGATTTACGAGGGACTGAAGTATCGCTCCGGCAACTGCGGCGTGTC
CATCATCCGATCGGGAGAGGCCATGGAGCAGGGACTGCGTGACTGCTGTC
GCTCCATTCGCATTGGAAAGATCCTGGTCGAGTCCGATGCCAATACGCAT
GAGGCCCGCGTGGTTTATGCCCGCTTTCCCGATGACATCGGCAGCAGGCA
GGTGCTACTCATGTACCCCATCATGTCCACGGGCAACACTGTGCTGCAGG
CGGTGAATGTGCTGCGGGAACACGGCGTACCCGAGAGCTGCATCATCCTG
TCCAATCTCTTCTGCACACCCATTGCCGCTCGGACCGTAGTGAATGCCTT
CCCCAAGCTGAAGATCCTCACCTCCGAGCTGCATCCCGTGGCACCTAATC
ACTTTGGCCAGAAATACTTCGGTACAGACTAGATACTTGGGTCTATCTCG
CAGACTTGACGACTAAGCGCTGCTTAGGATAGATTGCATTTGAGACACAC
AGACAAATAGACGACCCCTGCGGCCAACCAAACTACTACTTAGCAACTGT
TAGCTTTTCACAACTGGCTTTTAATGCAACTCTCAAATACGTTACGTTCG
TTACGCACTATTGTAAATATAGAAACGAAATAAATATTTAAACATTAAAA
AAAAAAAAAAAAAA

LD21741.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:50:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG5537-RA 1136 CG5537-RA 39..1135 1..1097 5485 100 Plus
CG5537.a 1075 CG5537.a 39..909 1..871 4355 100 Plus
CG5537.a 1075 CG5537.a 909..1074 932..1097 830 100 Plus
mad2.a 789 mad2.a 692..789 1097..1000 490 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:02:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 5803888..5804481 339..932 2955 99.8 Plus
chr3L 24539361 chr3L 5803485..5803823 1..339 1680 99.7 Plus
chr3L 24539361 chr3L 5804565..5804730 931..1096 830 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:10:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:02:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5811386..5811979 339..932 2970 100 Plus
3L 28110227 3L 5810983..5811321 1..339 1695 100 Plus
3L 28110227 3L 5812063..5812229 931..1097 835 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:16:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 5804486..5805079 339..932 2970 100 Plus
3L 28103327 3L 5804083..5804421 1..339 1695 100 Plus
3L 28103327 3L 5805163..5805329 931..1097 835 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:02:18 has no hits.

LD21741.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:03:33 Download gff for LD21741.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 5803485..5803822 1..338 99 -> Plus
chr3L 5803888..5804481 339..932 99 -> Plus
chr3L 5804567..5804730 933..1096 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:57:14 Download gff for LD21741.complete
Subject Subject Range Query Range Percent Splice Strand
CG5537-RA 1..786 97..882 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:20:09 Download gff for LD21741.complete
Subject Subject Range Query Range Percent Splice Strand
CG5537-RA 1..786 97..882 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:34:38 Download gff for LD21741.complete
Subject Subject Range Query Range Percent Splice Strand
CG5537-RA 1..786 97..882 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:46:24 Download gff for LD21741.complete
Subject Subject Range Query Range Percent Splice Strand
CG5537-RA 1..786 97..882 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:55:58 Download gff for LD21741.complete
Subject Subject Range Query Range Percent Splice Strand
CG5537-RA 1..786 97..882 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:53:55 Download gff for LD21741.complete
Subject Subject Range Query Range Percent Splice Strand
CG5537-RA 11..1106 1..1096 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:20:09 Download gff for LD21741.complete
Subject Subject Range Query Range Percent Splice Strand
CG5537-RA 11..1106 1..1096 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:34:38 Download gff for LD21741.complete
Subject Subject Range Query Range Percent Splice Strand
CG5537-RA 11..1106 1..1096 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:46:24 Download gff for LD21741.complete
Subject Subject Range Query Range Percent Splice Strand
CG5537-RA 11..1106 1..1096 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:55:58 Download gff for LD21741.complete
Subject Subject Range Query Range Percent Splice Strand
CG5537-RA 11..1106 1..1096 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:03:33 Download gff for LD21741.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5810983..5811320 1..338 100 -> Plus
3L 5811386..5811979 339..932 100 -> Plus
3L 5812065..5812228 933..1096 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:03:33 Download gff for LD21741.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5810983..5811320 1..338 100 -> Plus
3L 5811386..5811979 339..932 100 -> Plus
3L 5812065..5812228 933..1096 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:03:33 Download gff for LD21741.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5810983..5811320 1..338 100 -> Plus
3L 5811386..5811979 339..932 100 -> Plus
3L 5812065..5812228 933..1096 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:34:38 Download gff for LD21741.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5804083..5804420 1..338 100 -> Plus
arm_3L 5804486..5805079 339..932 100 -> Plus
arm_3L 5805165..5805328 933..1096 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:22:47 Download gff for LD21741.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5804083..5804420 1..338 100 -> Plus
3L 5804486..5805079 339..932 100 -> Plus
3L 5805165..5805328 933..1096 100   Plus

LD21741.pep Sequence

Translation from 96 to 881

> LD21741.pep
MRTGSPSSSGSQSEEGSSSSDHQQPQQEAQEQEQQLHTPTHAHAAVPAAT
SEEILAEYGSNLKLLECNSQVAELLTILRDKNTTRSDFKFYADRLIRLVI
EESLNQLPYTHCDVETPTGAIYEGLKYRSGNCGVSIIRSGEAMEQGLRDC
CRSIRIGKILVESDANTHEARVVYARFPDDIGSRQVLLMYPIMSTGNTVL
QAVNVLREHGVPESCIILSNLFCTPIAARTVVNAFPKLKILTSELHPVAP
NHFGQKYFGTD*

LD21741.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23996-PA 260 GF23996-PA 1..260 1..261 1176 88.6 Plus
Dana\GF13118-PA 618 GF13118-PA 403..613 61..261 454 44.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:23:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15291-PA 261 GG15291-PA 1..261 1..261 1372 98.1 Plus
Dere\GG20676-PA 617 GG20676-PA 402..612 61..261 454 44.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:23:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14521-PA 253 GH14521-PA 5..253 4..261 1140 84.5 Plus
Dgri\GH21395-PA 618 GH21395-PA 403..613 61..261 453 44.5 Plus
Dgri\GH23520-PA 219 GH23520-PA 4..214 61..261 450 44.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:47
Subject Length Description Subject Range Query Range Score Percent Strand
kri-PC 261 CG5537-PC 1..261 1..261 1346 100 Plus
kri-PA 261 CG5537-PA 1..261 1..261 1346 100 Plus
kri-PB 261 CG5537-PB 1..258 1..258 1329 100 Plus
l(2)k01209-PA 561 CG4798-PA 346..556 61..261 433 44.5 Plus
l(2)k01209-PD 626 CG4798-PD 411..621 61..261 433 44.5 Plus
l(2)k01209-PC 626 CG4798-PC 411..621 61..261 433 44.5 Plus
l(2)k01209-PB 626 CG4798-PB 411..621 61..261 433 44.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:23:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13298-PA 235 GI13298-PA 1..235 1..261 921 71.9 Plus
Dmoj\GI18574-PA 625 GI18574-PA 410..620 61..261 455 45 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:23:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21026-PA 258 GL21026-PA 1..258 1..261 1169 88.1 Plus
Dper\GL11422-PA 612 GL11422-PA 397..607 61..261 455 44.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:23:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18955-PA 258 GA18955-PA 1..258 1..261 1169 88.1 Plus
Dpse\GA24721-PA 610 GA24721-PA 395..605 61..261 455 44.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:23:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14723-PA 261 GM14723-PA 1..261 1..261 1386 98.9 Plus
Dsec\GM21771-PA 612 GM21771-PA 397..607 61..261 445 44.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:23:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11264-PA 625 GD11264-PA 410..620 61..261 445 44.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:23:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12067-PA 253 GJ12067-PA 5..253 4..261 1100 82.2 Plus
Dvir\GJ20368-PA 624 GJ20368-PA 409..619 61..261 449 44.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:23:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16656-PA 267 GK16656-PA 1..267 1..261 1156 86.6 Plus
Dwil\GK21883-PA 611 GK21883-PA 396..606 61..261 454 44.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:23:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21512-PA 261 GE21512-PA 1..261 1..261 1373 98.1 Plus
Dyak\GE11659-PA 623 GE11659-PA 408..618 61..261 451 44.5 Plus

LD21741.hyp Sequence

Translation from 96 to 881

> LD21741.hyp
MRTGSPSSSGSQSEEGSSSSDHQQPQQEAQEQEQQLHTPTHAHAAVPAAT
SEEILAEYGSNLKLLECNSQVAELLTILRDKNTTRSDFKFYADRLIRLVI
EESLNQLPYTHCDVETPTGAIYEGLKYRSGNCGVSIIRSGEAMEQGLRDC
CRSIRIGKILVESDANTHEARVVYARFPDDIGSRQVLLMYPIMSTGNTVL
QAVNVLREHGVPESCIILSNLFCTPIAARTVVNAFPKLKILTSELHPVAP
NHFGQKYFGTD*

LD21741.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:39:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG5537-PC 261 CG5537-PC 1..261 1..261 1346 100 Plus
CG5537-PA 261 CG5537-PA 1..261 1..261 1346 100 Plus
CG5537-PB 261 CG5537-PB 1..258 1..258 1329 100 Plus
l(2)k01209-PA 561 CG4798-PA 346..556 61..261 433 44.5 Plus
l(2)k01209-PD 626 CG4798-PD 411..621 61..261 433 44.5 Plus