Clone LD21756 Report

Search the DGRC for LD21756

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:217
Well:56
Vector:pOT2
Associated Gene/TranscriptRpL4-RA
Protein status:LD21756.pep: gold
Preliminary Size:1443
Sequenced Size:1386

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5502 2001-01-01 Release 2 assignment
CG5502 2001-11-29 Blastp of sequenced clone
CG5502 2003-01-01 Sim4 clustering to Release 3
RpL4 2008-04-29 Release 5.5 accounting
RpL4 2008-08-15 Release 5.9 accounting
RpL4 2008-12-18 5.12 accounting

Clone Sequence Records

LD21756.complete Sequence

1386 bp (1386 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069485

> LD21756.complete
AGGACGGTATCTGCGTTTGCAGAATATTTAGCACCTTTCATTGGGTTTGA
AAATCAACGAAAATGAGCTTAGGCAACGCCAGGCCATTGGTCTCCGTGTA
CACGGAAAAGAACGAGCCAGCCAAGGACAAGAACATATGCCTGCCGGCAG
TGTTCAAGGCGCCCATTCGTCCGGATGTGGTCAACGAGGTTCACCAGCTG
CTCCGCCGCAACAACCGACAGGCCTACGCCGTCAGCGAGCTGGCTGGTCA
CCAGACCTCCGCCGAGTCCTGGGGTACCGGACGTGCTGTGGCCCGTATTC
CCCGTGTGCGTGGTGGCGGTACCCACCGTTCCGGCCAGGGAGCCTTCGGC
AACATGTGCCGTGGTGGACGCATGTTCGCCCCCACCAAGACGTTCCGTCG
CTGGCACCGCAAGGTGAATGTCAACCAGCGTCGCTACGCCCTGGTGTCGG
CCATCGCCGCCTCAGGAGTGCCAGCTCTGGTCCAGTCCAAGGGACATGTC
ATCGACGGCGTCTCCGAGTTCCCGCTGGTCGTGTCCGATGAGGTGCAAAA
GGTCCAGAAGACCAAGCAGGCTGTCATCTTCCTGCGTCGCCTGAAGATCT
GGGCTGACATCCAGAAGGTGTACAAGTCGCAGCGCTTCCGTGCTGGCCGT
GGTACCATGCGCGACCGTCGCCGCATCGCTCGCCGTGGTCCCCTGGTGGT
CTACGACAAGGACGAGGGTCTGCGCAAGGCCTTCCGCAACATCCCCGGCA
TTGAGACCATCAACGTGGACAAGCTCAATCTGCTGAAGCTGGCCCCCGGC
GGTCATGTCGGTCGCTTTGTCATCTGGACCGAGTCGGCTTTCGCCCGCCT
GAACGATCTGTTCGGCACCTGGAAGAAGCCGTCCACCTTGAAGAAGGGCT
ACAACCTGCCCCAGCCCAAGATGGCCAACACCGATCTGTCGCGTCTGCTC
AAGTCTGAGGAGATCCGCAAGGTGTTGCGCGATCCCCGCAAGCGTGTGTT
CCGCAGCGTGCGCCGCCTGAACCCCCTGACCAACGTGCGCCAGCTGATCA
AGCTTAACCCCTATGCCGAGGTCCTCAAGCGTCGTGCCGCCCTCGCCGCC
GAGAAGCGCACCGTGGCCAAGGTGCTGGCCAAGGCCAAGAAGCAGAACGT
CGAGCTGGCCAAGTCGCACTTCGCCAATGTGGCCACCAAGGCTGCGGCCA
ATCGCGCCAAGCTGCTGGCCGCCCGCAAGAAGAAGGTCGCCGCCAAGAAG
CCAGCGGCCAAGAAGTAAACTTACTTTCCCCCGAGTAGAGCTGACACACT
TTTATATTATAATAAACCACAAAAGTTGTATGAATTTTATTCATAATACA
TAGAGTGCGCGACAGTAAAAAAAAAAAAAAAAAAAA

LD21756.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
RpL4-RA 1655 RpL4-RA 94..1461 1..1368 6840 100 Plus
RpL4.a 1700 RpL4.a 335..1638 65..1368 6520 100 Plus
RpL4.a 1700 RpL4.a 66..130 1..65 325 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:34:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23747100..23747850 616..1366 3755 100 Plus
chr3R 27901430 chr3R 23746331..23746705 246..620 1875 100 Plus
chr3R 27901430 chr3R 23746086..23746269 65..248 905 99.5 Plus
chr3R 27901430 chr3R 23745817..23745881 1..65 325 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:10:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:34:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27924138..27924890 616..1368 3765 100 Plus
3R 32079331 3R 27923369..27923743 246..620 1875 100 Plus
3R 32079331 3R 27923124..27923307 65..248 920 100 Plus
3R 32079331 3R 27922855..27922919 1..65 325 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:17:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 27664969..27665721 616..1368 3765 100 Plus
3R 31820162 3R 27664200..27664574 246..620 1875 100 Plus
3R 31820162 3R 27663955..27664138 65..248 920 100 Plus
3R 31820162 3R 27663686..27663750 1..65 325 100 Plus
Blast to na_te.dros performed on 2019-03-15 13:34:06 has no hits.

LD21756.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:34:52 Download gff for LD21756.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 23745817..23745881 1..65 100 -> Plus
chr3R 23746087..23746267 66..246 99 -> Plus
chr3R 23746332..23746702 247..617 100 -> Plus
chr3R 23747102..23747850 618..1366 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:57:17 Download gff for LD21756.complete
Subject Subject Range Query Range Percent Splice Strand
RpL4-RA 1..1206 63..1268 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:21:23 Download gff for LD21756.complete
Subject Subject Range Query Range Percent Splice Strand
RpL4-RA 1..1206 63..1268 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:04:43 Download gff for LD21756.complete
Subject Subject Range Query Range Percent Splice Strand
RpL4-RA 1..1206 63..1268 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:47:43 Download gff for LD21756.complete
Subject Subject Range Query Range Percent Splice Strand
RpL4-RA 1..1206 63..1268 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:33:38 Download gff for LD21756.complete
Subject Subject Range Query Range Percent Splice Strand
RpL4-RA 1..1206 63..1268 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:55:37 Download gff for LD21756.complete
Subject Subject Range Query Range Percent Splice Strand
RpL4-RA 63..1428 1..1366 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:21:23 Download gff for LD21756.complete
Subject Subject Range Query Range Percent Splice Strand
RpL4-RA 63..1428 1..1366 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:04:43 Download gff for LD21756.complete
Subject Subject Range Query Range Percent Splice Strand
RpL4-RA 35..1400 1..1366 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:47:43 Download gff for LD21756.complete
Subject Subject Range Query Range Percent Splice Strand
RpL4-RA 63..1428 1..1366 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:33:38 Download gff for LD21756.complete
Subject Subject Range Query Range Percent Splice Strand
RpL4-RA 35..1400 1..1366 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:34:52 Download gff for LD21756.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27922855..27922919 1..65 100 -> Plus
3R 27923125..27923305 66..246 100 -> Plus
3R 27923370..27923740 247..617 100 -> Plus
3R 27924140..27924888 618..1366 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:34:52 Download gff for LD21756.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27922855..27922919 1..65 100 -> Plus
3R 27923125..27923305 66..246 100 -> Plus
3R 27923370..27923740 247..617 100 -> Plus
3R 27924140..27924888 618..1366 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:34:52 Download gff for LD21756.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27922855..27922919 1..65 100 -> Plus
3R 27923125..27923305 66..246 100 -> Plus
3R 27923370..27923740 247..617 100 -> Plus
3R 27924140..27924888 618..1366 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:04:43 Download gff for LD21756.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23748577..23748641 1..65 100 -> Plus
arm_3R 23748847..23749027 66..246 100 -> Plus
arm_3R 23749092..23749462 247..617 100 -> Plus
arm_3R 23749862..23750610 618..1366 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:24:09 Download gff for LD21756.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27664201..27664571 247..617 100 -> Plus
3R 27664971..27665719 618..1366 100   Plus
3R 27663686..27663750 1..65 100 -> Plus
3R 27663956..27664136 66..246 100 -> Plus

LD21756.pep Sequence

Translation from 62 to 1267

> LD21756.pep
MSLGNARPLVSVYTEKNEPAKDKNICLPAVFKAPIRPDVVNEVHQLLRRN
NRQAYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCR
GGRMFAPTKTFRRWHRKVNVNQRRYALVSAIAASGVPALVQSKGHVIDGV
SEFPLVVSDEVQKVQKTKQAVIFLRRLKIWADIQKVYKSQRFRAGRGTMR
DRRRIARRGPLVVYDKDEGLRKAFRNIPGIETINVDKLNLLKLAPGGHVG
RFVIWTESAFARLNDLFGTWKKPSTLKKGYNLPQPKMANTDLSRLLKSEE
IRKVLRDPRKRVFRSVRRLNPLTNVRQLIKLNPYAEVLKRRAALAAEKRT
VAKVLAKAKKQNVELAKSHFANVATKAAANRAKLLAARKKKVAAKKPAAK
K*

LD21756.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18868-PA 401 GF18868-PA 1..401 1..401 2033 96.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11580-PA 401 GG11580-PA 1..401 1..401 2087 99.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:32:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18408-PA 401 GH18408-PA 1..385 1..385 1949 95.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:42
Subject Length Description Subject Range Query Range Score Percent Strand
RpL4-PA 401 CG5502-PA 1..401 1..401 2035 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:32:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24311-PA 401 GI24311-PA 1..401 1..401 2049 97 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23641-PA 401 GL23641-PA 1..401 1..401 2058 98 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18932-PA 401 GA18932-PA 1..401 1..401 2051 97.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16362-PA 411 GM16362-PA 1..411 1..401 1940 92.9 Plus
Dsec\GM24605-PA 216 GM24605-PA 1..216 186..401 1088 99.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21356-PA 401 GD21356-PA 1..401 1..401 2076 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:32:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10395-PA 401 GJ10395-PA 1..401 1..401 2031 96.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:32:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12825-PA 427 GK12825-PA 28..427 2..401 2033 96.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:32:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpL4-PA 401 GE23769-PA 1..401 1..401 2087 99.8 Plus

LD21756.hyp Sequence

Translation from 62 to 1267

> LD21756.hyp
MSLGNARPLVSVYTEKNEPAKDKNICLPAVFKAPIRPDVVNEVHQLLRRN
NRQAYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCR
GGRMFAPTKTFRRWHRKVNVNQRRYALVSAIAASGVPALVQSKGHVIDGV
SEFPLVVSDEVQKVQKTKQAVIFLRRLKIWADIQKVYKSQRFRAGRGTMR
DRRRIARRGPLVVYDKDEGLRKAFRNIPGIETINVDKLNLLKLAPGGHVG
RFVIWTESAFARLNDLFGTWKKPSTLKKGYNLPQPKMANTDLSRLLKSEE
IRKVLRDPRKRVFRSVRRLNPLTNVRQLIKLNPYAEVLKRRAALAAEKRT
VAKVLAKAKKQNVELAKSHFANVATKAAANRAKLLAARKKKVAAKKPAAK
K*

LD21756.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:11:47
Subject Length Description Subject Range Query Range Score Percent Strand
RpL4-PA 401 CG5502-PA 1..401 1..401 2035 100 Plus