Clone LD21828 Report

Search the DGRC for LD21828

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:218
Well:28
Vector:pOT2
Associated Gene/TranscriptCG5171-RA
Protein status:LD21828.pep: gold
Preliminary Size:1300
Sequenced Size:1130

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5171 2001-01-01 Release 2 assignment
CG5171 2002-05-15 Blastp of sequenced clone
CG5171 2003-01-01 Sim4 clustering to Release 3
CG5171 2008-04-29 Release 5.5 accounting
CG5171 2008-08-15 Release 5.9 accounting
CG5171 2008-12-18 5.12 accounting

Clone Sequence Records

LD21828.complete Sequence

1130 bp (1130 high quality bases) assembled on 2002-05-15

GenBank Submission: AY118914

> LD21828.complete
ATCAGGGATAGGTGTCGATAGCCGCTCGAGAAGTTCCAAGTACCCGGCTA
CCTTAAGTGAAATCTATCGTATTTTTATTGGCATTACTTCTAAACGCGAC
AAGGAGTTATCGGGAAATTGTGAAAATGCCTGAGAAACAAGTGGCACCTG
TAATTAGTAATCTCGAGGATTTTGCGAATAATTTACCTGGGTATCTAATT
TCTGAAAGTCCAGTTGCCGTACTCCTGGACTACGATGGCACCCTAGCTCC
CATTGCGGATAATCCAGCGAAGACCAAAATGCCCGTGGAACTGGAGGCCA
TACTGCACAAGATAGCCAAGCATCCCAAAGTTTTTCTCGCTGTGATCTCG
GGTCGCGGACTGAAAGATGTGCAAAAACAAGTAAATATCGATGGCATTAC
ATATGCTGGTAATCATGGACTGGAAATCGAGTATCCCGATGGCTCCAGGC
ACGATTACGAGCTACCCACGGAGATCCAGAAAAACTACACACAAATGGTT
AGGGAGCTCAAGGAGAAGGTGGAGAAGAATGGAGCCTGGGTGGAGGATAA
GAAGGTGTCACTCACCTACCACTACAGAGATACGCCCGCAGCCCTGAAGG
ATCAGCAAAAGCAGTTGGCTTCGGAGATCTGCACAAAGTTCGGATTCCGT
GCGAATCAGGCCCATGAAGCCATCGAAGCTAAGCCCCCAGTGAATTGGAA
CAAGGGAGAGGCTGCCGTGTATATTCTGAAGCAGAAATTCGGGGATAATT
GGTCGCAGAAAGTGAGTGTGGTCTTTGCGGGCGATGACACCACCGATGAA
GATGCCATGAGAGTGCTTCGAGGCTTGGGTCGCTCGTTTAGAATTTCTGC
TGATGCCCAGATTCAAACTTATGCGGATTTCCGGTTGCCCAAGCAGGCTG
TAATGACCGATCTTCTCAAATGGATAGCCAATGTGTATGTTTCTTAGATG
TAATCGAATTTATAAAATCTAAAAAGTTTGTTGATTTGTTACATACATAT
AATATAATTTGAAATTCTGTTTTTGCATAAGCAATATTGAAATTTAATAT
AAAATGTATATGTATTTGATTAGTTAGTGGCATTAGAATAAATTATATGC
TTTTAATCTAAAAAAAAAAAAAAAAAAAAA

LD21828.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:08:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG5171-RC 1255 CG5171-RC 30..1139 1..1110 5550 100 Plus
CG5171-RA 1296 CG5171-RA 71..1180 1..1110 5550 100 Plus
CG5171-RB 1543 CG5171-RB 373..1427 56..1110 5275 100 Plus
CG5171-RB 1543 CG5171-RB 75..131 1..57 285 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:34:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 7402588..7403213 190..815 3085 99.5 Plus
chr2L 23010047 chr2L 7403277..7403573 813..1109 1470 99.7 Plus
chr2L 23010047 chr2L 7402272..7402409 56..193 690 100 Plus
chr2L 23010047 chr2L 7401974..7402030 1..57 270 98.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:10:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:34:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7403541..7404166 190..815 3130 100 Plus
2L 23513712 2L 7404230..7404527 813..1110 1490 100 Plus
2L 23513712 2L 7403227..7403364 56..193 690 100 Plus
2L 23513712 2L 7402929..7402985 1..57 285 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:39:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7403541..7404166 190..815 3130 100 Plus
2L 23513712 2L 7404230..7404527 813..1110 1490 100 Plus
2L 23513712 2L 7403227..7403364 56..193 690 100 Plus
2L 23513712 2L 7402929..7402985 1..57 285 100 Plus
Blast to na_te.dros performed 2019-03-15 13:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 2397..2477 989..1071 139 69.4 Plus
roo 9092 roo DM_ROO 9092bp 1187..1276 1092..1006 128 62.2 Minus

LD21828.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:34:56 Download gff for LD21828.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 7401974..7402030 1..57 98 -> Plus
chr2L 7402274..7402406 58..190 100 -> Plus
chr2L 7402589..7403210 191..812 99 -> Plus
chr2L 7403277..7403573 813..1109 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:57:26 Download gff for LD21828.complete
Subject Subject Range Query Range Percent Splice Strand
CG5171-RC 1..822 126..947 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:51:34 Download gff for LD21828.complete
Subject Subject Range Query Range Percent Splice Strand
CG5171-RD 2..891 58..947 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:04:51 Download gff for LD21828.complete
Subject Subject Range Query Range Percent Splice Strand
CG5171-RD 2..891 58..947 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:44:09 Download gff for LD21828.complete
Subject Subject Range Query Range Percent Splice Strand
CG5171-RC 1..822 126..947 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:33:46 Download gff for LD21828.complete
Subject Subject Range Query Range Percent Splice Strand
CG5171-RD 2..891 58..947 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:29:26 Download gff for LD21828.complete
Subject Subject Range Query Range Percent Splice Strand
CG5171-RC 30..1138 1..1109 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:51:34 Download gff for LD21828.complete
Subject Subject Range Query Range Percent Splice Strand
CG5171-RC 30..1138 1..1109 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:04:51 Download gff for LD21828.complete
Subject Subject Range Query Range Percent Splice Strand
CG5171-RA 24..1132 1..1109 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:44:09 Download gff for LD21828.complete
Subject Subject Range Query Range Percent Splice Strand
CG5171-RC 30..1138 1..1109 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:33:46 Download gff for LD21828.complete
Subject Subject Range Query Range Percent Splice Strand
CG5171-RA 24..1132 1..1109 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:34:56 Download gff for LD21828.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7403229..7403361 58..190 100 -> Plus
2L 7402929..7402985 1..57 100 -> Plus
2L 7403542..7404163 191..812 100 -> Plus
2L 7404230..7404526 813..1109 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:34:56 Download gff for LD21828.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7403229..7403361 58..190 100 -> Plus
2L 7402929..7402985 1..57 100 -> Plus
2L 7403542..7404163 191..812 100 -> Plus
2L 7404230..7404526 813..1109 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:34:56 Download gff for LD21828.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7403229..7403361 58..190 100 -> Plus
2L 7402929..7402985 1..57 100 -> Plus
2L 7403542..7404163 191..812 100 -> Plus
2L 7404230..7404526 813..1109 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:04:51 Download gff for LD21828.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7402929..7402985 1..57 100 -> Plus
arm_2L 7403229..7403361 58..190 100 -> Plus
arm_2L 7403542..7404163 191..812 100 -> Plus
arm_2L 7404230..7404526 813..1109 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:16:31 Download gff for LD21828.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7403542..7404163 191..812 100 -> Plus
2L 7404230..7404526 813..1109 100   Plus
2L 7402929..7402985 1..57 100 -> Plus
2L 7403229..7403361 58..190 100 -> Plus

LD21828.pep Sequence

Translation from 125 to 946

> LD21828.pep
MPEKQVAPVISNLEDFANNLPGYLISESPVAVLLDYDGTLAPIADNPAKT
KMPVELEAILHKIAKHPKVFLAVISGRGLKDVQKQVNIDGITYAGNHGLE
IEYPDGSRHDYELPTEIQKNYTQMVRELKEKVEKNGAWVEDKKVSLTYHY
RDTPAALKDQQKQLASEICTKFGFRANQAHEAIEAKPPVNWNKGEAAVYI
LKQKFGDNWSQKVSVVFAGDDTTDEDAMRVLRGLGRSFRISADAQIQTYA
DFRLPKQAVMTDLLKWIANVYVS*

LD21828.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:45:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15857-PA 273 GF15857-PA 1..273 1..273 1276 85.7 Plus
Dana\GF21145-PA 809 GF21145-PA 513..768 12..267 671 45.7 Plus
Dana\GF15858-PA 276 GF15858-PA 1..270 1..271 581 41.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:45:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10474-PA 273 GG10474-PA 1..273 1..273 1345 92.7 Plus
Dere\GG24998-PA 809 GG24998-PA 513..768 12..267 667 45.3 Plus
Dere\GG10475-PA 276 GG10475-PA 1..270 1..271 579 41.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:45:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13732-PA 275 GH13732-PA 1..273 1..273 1179 76.9 Plus
Dgri\GH13731-PA 273 GH13731-PA 1..273 1..273 1134 73.6 Plus
Dgri\GH13210-PA 809 GH13210-PA 513..768 12..267 674 45.7 Plus
Dgri\GH13733-PA 275 GH13733-PA 1..253 1..254 571 41.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG5171-PF 273 CG5171-PF 1..273 1..273 1417 100 Plus
CG5171-PE 273 CG5171-PE 1..273 1..273 1417 100 Plus
CG5171-PD 296 CG5171-PD 24..296 1..273 1417 100 Plus
CG5171-PA 273 CG5171-PA 1..273 1..273 1417 100 Plus
CG5171-PB 273 CG5171-PB 1..273 1..273 1417 100 Plus
Tps1-PA 809 CG4104-PA 513..768 12..267 651 45.3 Plus
CG5177-PB 276 CG5177-PB 1..270 1..271 585 41.5 Plus
CG5177-PA 276 CG5177-PA 1..270 1..271 585 41.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:45:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23729-PA 273 GI23729-PA 1..273 1..273 1186 78 Plus
Dmoj\GI22062-PA 809 GI22062-PA 513..768 12..267 662 45.3 Plus
Dmoj\GI23740-PA 276 GI23740-PA 1..253 1..254 583 42.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:45:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15110-PA 809 GL15110-PA 513..768 12..267 673 46.5 Plus
Dper\GL25814-PA 276 GL25814-PA 1..270 1..271 618 43.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:45:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18709-PA 273 GA18709-PA 1..273 1..273 1218 79.9 Plus
Dpse\GA17960-PA 809 GA17960-PA 513..768 12..267 673 46.5 Plus
Dpse\GA18712-PA 276 GA18712-PA 1..270 1..271 572 40.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:45:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16411-PA 273 GM16411-PA 1..273 1..273 1427 97.8 Plus
Dsec\GM18467-PA 796 GM18467-PA 500..755 12..267 671 45.7 Plus
Dsec\GM16422-PA 276 GM16422-PA 1..270 1..271 580 41.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:45:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23468-PA 273 GD23468-PA 1..273 1..273 1430 97.8 Plus
Dsim\GD23282-PA 809 GD23282-PA 513..768 12..267 672 45.7 Plus
Dsim\GD23469-PA 276 GD23469-PA 1..270 1..271 580 41.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:45:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20926-PA 273 GJ20926-PA 1..273 1..273 1169 76.6 Plus
Dvir\GJ16123-PA 809 GJ16123-PA 513..768 12..267 661 45.3 Plus
Dvir\GJ20937-PA 276 GJ20937-PA 1..270 1..271 570 40.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:45:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24303-PA 272 GK24303-PA 1..272 1..272 1215 80.5 Plus
Dwil\GK24698-PA 809 GK24698-PA 513..768 12..267 662 44.9 Plus
Dwil\GK24304-PA 276 GK24304-PA 1..270 1..271 579 40.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:45:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14513-PA 273 GE14513-PA 1..273 1..273 1382 94.1 Plus
Dyak\GE18284-PA 809 GE18284-PA 513..768 12..267 667 45.3 Plus
Dyak\GE14524-PA 276 GE14524-PA 1..270 1..271 580 41.2 Plus

LD21828.hyp Sequence

Translation from 125 to 946

> LD21828.hyp
MPEKQVAPVISNLEDFANNLPGYLISESPVAVLLDYDGTLAPIADNPAKT
KMPVELEAILHKIAKHPKVFLAVISGRGLKDVQKQVNIDGITYAGNHGLE
IEYPDGSRHDYELPTEIQKNYTQMVRELKEKVEKNGAWVEDKKVSLTYHY
RDTPAALKDQQKQLASEICTKFGFRANQAHEAIEAKPPVNWNKGEAAVYI
LKQKFGDNWSQKVSVVFAGDDTTDEDAMRVLRGLGRSFRISADAQIQTYA
DFRLPKQAVMTDLLKWIANVYVS*

LD21828.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:28:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG5171-PF 273 CG5171-PF 1..273 1..273 1417 100 Plus
CG5171-PE 273 CG5171-PE 1..273 1..273 1417 100 Plus
CG5171-PA 273 CG5171-PA 1..273 1..273 1417 100 Plus
CG5171-PB 273 CG5171-PB 1..273 1..273 1417 100 Plus
CG5171-PD 296 CG5171-PD 24..296 1..273 1417 100 Plus