Clone LD21907 Report

Search the DGRC for LD21907

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:219
Well:7
Vector:pOT2
Associated Gene/TranscriptBigH1-RA
Protein status:LD21907.pep: gold
Preliminary Size:1300
Sequenced Size:1260

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3509 2001-01-01 Release 2 assignment
CG3509 2002-05-15 Blastp of sequenced clone
CG3509 2003-01-01 Sim4 clustering to Release 3
CG3509 2008-04-29 Release 5.5 accounting
CG3509 2008-08-15 Release 5.9 accounting
CG3509 2008-12-18 5.12 accounting

Clone Sequence Records

LD21907.complete Sequence

1260 bp (1260 high quality bases) assembled on 2002-05-15

GenBank Submission: AY118915

> LD21907.complete
TTACTGCGAGTTTTCGATTACCGTTTTGTTAACCTTTTTTCGTGTCTTAA
AAGTTGTTGAGTTGTATTTCTAATTTTTGTTCAATTTAATTTCCAACTAA
TAACATGAAACTAAAGCCGGTTGAACGCAATGATGGCTCGGATGATGAGA
GCGAGGAGGAAATGCCAAATGATCATCCCGAATCCGAAGACTCCAATATG
GGCGAAGAAGAGGAGCTCCCGGAGGAAGATGAGGAGGAGATGGAGGAGGA
TGAGGAGGAGGATCGGCAGGACGGTGACGAGGTCGAGACAGATAATCTCG
GAGCTGATCGCAATCCCTATCCCACTCCGCCGCCTGATGATGGGTCGAAA
CTGGTGCCCCCCGATTCTGACAACCCCAAGTCGATGGTCCCAAAACCAAA
GGGTACGCTCATATCCCTAGCTCTTATGGCCATCGGGAAGTTGGCGAGCC
GATCGGGCTCATCGGTTCAGGCCATAATGACATACCTAAAGGACAATGGT
CAGGAGTGGAAGGATCCGAAGAAAACCGCCCGCCTCCTCCATCGAGCTTT
AAAATTGGCCGAAGCCAACGGCGAAGTGGTGATGGTTAAGCGATCCTTTA
AACTCACCGATAAGCAGAAGAACTCCTCAAAGGCTGTGGAGAAAATGAAG
GCAAAGAAACAGAAGGAGAAGGAAAAGAAAGCCAAAGTTGAGAAAGTTTT
AAAGGAGAAGATTCAAAAGAAAGAGGCCAAGGCGAAGATGAAGGAAAAGA
AGGCCTCCAAGGAAAAATCCAGTAAACCAACCGAGCGGAAAACAAAACAA
GCTGTAAAAAAGAAGAAGCCCGAGGATGGAACCAAGGATAATCCGCCAGC
ATCTAAAGCAGCTTCATCCGCTGCCGCGCAGGCCATGCTGGAAACATCCC
AGACAGCGATTCCTGAAGCGGGAAAGAAGCCGGCCAAAACCAAAGTCAAG
CTACAAGCGGATTCATCCGAGGCGGGAAAGACTAAAAAGTCGCGAAAGTC
CATTGGAACTCTGGCTCAGCCCAAGGCAGCCAGGCCGAAAGTCAAGGCGG
TCAAGAAACTGGTGGCTGGAAAGGGAGCCTCCACACCGGATCTTTCCATA
ATGGAGGCCCAGGCCACGTCGACTCCTCAAGGAGCTACCAAGGCGAAGCG
CAAGCGCAAAGTCTAGTTATGATTTATATGTTTTTTTTTCAGTACATGTG
AAACTTTGTTTAAATAAAATTGATACTTTTTTAGTTCCTAGCAAAAAAAA
AAAAAAAAAA

LD21907.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG3509-RA 1315 CG3509-RA 61..1304 1..1244 6220 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:34:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10488239..10489039 1..801 4005 100 Plus
chr3R 27901430 chr3R 10489133..10489574 801..1242 2210 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:10:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14663487..14664287 1..801 4005 100 Plus
3R 32079331 3R 14664381..14664824 801..1244 2220 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:39:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14404318..14405118 1..801 4005 100 Plus
3R 31820162 3R 14405212..14405655 801..1244 2220 100 Plus
Blast to na_te.dros performed 2019-03-16 16:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1a 5108 Rt1a DME278684 5108bp Derived from AJ278684 (AJ278684.1) (Rel. 64, Last updated, Version 1). 318..376 109..52 148 74.6 Minus

LD21907.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:35:41 Download gff for LD21907.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 10488991..10489038 753..800 100 -> Plus
chr3R 10489133..10489574 801..1242 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:57:35 Download gff for LD21907.complete
Subject Subject Range Query Range Percent Splice Strand
CG3509-RA 1..1062 105..1166 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:51:36 Download gff for LD21907.complete
Subject Subject Range Query Range Percent Splice Strand
CG3509-RA 1..1062 105..1166 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:18:03 Download gff for LD21907.complete
Subject Subject Range Query Range Percent Splice Strand
CG3509-RA 1..1062 105..1166 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:44:11 Download gff for LD21907.complete
Subject Subject Range Query Range Percent Splice Strand
CG3509-RA 1..1062 105..1166 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:33:48 Download gff for LD21907.complete
Subject Subject Range Query Range Percent Splice Strand
BigH1-RA 1..1062 105..1166 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:29:30 Download gff for LD21907.complete
Subject Subject Range Query Range Percent Splice Strand
CG3509-RA 45..1286 1..1242 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:51:36 Download gff for LD21907.complete
Subject Subject Range Query Range Percent Splice Strand
CG3509-RA 45..1286 1..1242 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:18:03 Download gff for LD21907.complete
Subject Subject Range Query Range Percent Splice Strand
CG3509-RA 45..1286 1..1242 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:44:11 Download gff for LD21907.complete
Subject Subject Range Query Range Percent Splice Strand
CG3509-RA 45..1286 1..1242 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:33:48 Download gff for LD21907.complete
Subject Subject Range Query Range Percent Splice Strand
BigH1-RA 38..1279 1..1242 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:35:41 Download gff for LD21907.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14663487..14664286 1..800 100 -> Plus
3R 14664381..14664822 801..1242 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:35:41 Download gff for LD21907.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14663487..14664286 1..800 100 -> Plus
3R 14664381..14664822 801..1242 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:35:41 Download gff for LD21907.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14663487..14664286 1..800 100 -> Plus
3R 14664381..14664822 801..1242 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:18:03 Download gff for LD21907.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10489209..10490008 1..800 100 -> Plus
arm_3R 10490103..10490544 801..1242 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:16:34 Download gff for LD21907.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14404318..14405117 1..800 100 -> Plus
3R 14405212..14405653 801..1242 100   Plus

LD21907.pep Sequence

Translation from 104 to 1165

> LD21907.pep
MKLKPVERNDGSDDESEEEMPNDHPESEDSNMGEEEELPEEDEEEMEEDE
EEDRQDGDEVETDNLGADRNPYPTPPPDDGSKLVPPDSDNPKSMVPKPKG
TLISLALMAIGKLASRSGSSVQAIMTYLKDNGQEWKDPKKTARLLHRALK
LAEANGEVVMVKRSFKLTDKQKNSSKAVEKMKAKKQKEKEKKAKVEKVLK
EKIQKKEAKAKMKEKKASKEKSSKPTERKTKQAVKKKKPEDGTKDNPPAS
KAASSAAAQAMLETSQTAIPEAGKKPAKTKVKLQADSSEAGKTKKSRKSI
GTLAQPKAARPKVKAVKKLVAGKGASTPDLSIMEAQATSTPQGATKAKRK
RKV*

LD21907.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:45:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18591-PA 351 GF18591-PA 49..351 56..353 456 50.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:45:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16870-PA 347 GG16870-PA 1..336 1..342 1034 77.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:45:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18895-PA 294 GH18895-PA 32..118 70..167 161 42.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
BigH1-PA 353 CG3509-PA 1..353 1..353 1771 100 Plus
futsch-PF 5495 CG34387-PF 1997..2334 10..353 158 20 Plus
futsch-PE 5495 CG34387-PE 1997..2334 10..353 158 20 Plus
futsch-PC 5495 CG34387-PC 1997..2334 10..353 158 20 Plus
futsch-PF 5495 CG34387-PF 3349..3666 7..353 156 21.1 Plus
futsch-PE 5495 CG34387-PE 3349..3666 7..353 156 21.1 Plus
futsch-PC 5495 CG34387-PC 3349..3666 7..353 156 21.1 Plus
His1:CG33861-PA 256 CG33861-PA 56..256 109..318 149 28.3 Plus
His1:CG33858-PA 256 CG33858-PA 56..256 109..318 149 28.3 Plus
His1:CG33855-PA 256 CG33855-PA 56..256 109..318 149 28.3 Plus
His1:CG33834-PA 256 CG33834-PA 56..256 109..318 149 28.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:45:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24753-PA 285 GI24753-PA 18..279 99..349 265 40.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:45:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14299-PA 388 GL14299-PA 112..388 97..352 218 39.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:45:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22744-PA 421 GA22744-PA 112..206 97..191 210 47.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:45:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24179-PA 352 GM24179-PA 1..352 1..353 1069 88.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:45:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18972-PA 352 GD18972-PA 1..352 1..353 1057 88.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24251-PA 350 GE24251-PA 1..350 1..353 934 76.6 Plus

LD21907.hyp Sequence

Translation from 104 to 1165

> LD21907.hyp
MKLKPVERNDGSDDESEEEMPNDHPESEDSNMGEEEELPEEDEEEMEEDE
EEDRQDGDEVETDNLGADRNPYPTPPPDDGSKLVPPDSDNPKSMVPKPKG
TLISLALMAIGKLASRSGSSVQAIMTYLKDNGQEWKDPKKTARLLHRALK
LAEANGEVVMVKRSFKLTDKQKNSSKAVEKMKAKKQKEKEKKAKVEKVLK
EKIQKKEAKAKMKEKKASKEKSSKPTERKTKQAVKKKKPEDGTKDNPPAS
KAASSAAAQAMLETSQTAIPEAGKKPAKTKVKLQADSSEAGKTKKSRKSI
GTLAQPKAARPKVKAVKKLVAGKGASTPDLSIMEAQATSTPQGATKAKRK
RKV*

LD21907.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
BigH1-PA 353 CG3509-PA 1..353 1..353 1771 100 Plus
futsch-PF 5495 CG34387-PF 1997..2334 10..353 158 20 Plus
futsch-PE 5495 CG34387-PE 1997..2334 10..353 158 20 Plus
futsch-PC 5495 CG34387-PC 1997..2334 10..353 158 20 Plus
futsch-PF 5495 CG34387-PF 3349..3666 7..353 156 21.1 Plus
futsch-PE 5495 CG34387-PE 3349..3666 7..353 156 21.1 Plus
futsch-PC 5495 CG34387-PC 3349..3666 7..353 156 21.1 Plus
His1:CG33861-PA 256 CG33861-PA 56..256 109..318 149 28.3 Plus