Clone LD21957 Report

Search the DGRC for LD21957

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:219
Well:57
Vector:pOT2
Associated Gene/TranscriptCG5220-RA
Protein status:LD21957.pep: gold
Preliminary Size:1300
Sequenced Size:1056

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5220 2001-01-01 Release 2 assignment
CG5220 2002-07-13 Blastp of sequenced clone
CG5220 2003-01-01 Sim4 clustering to Release 3
CG5220 2008-04-29 Release 5.5 accounting
CG5220 2008-08-15 Release 5.9 accounting
CG5220 2008-12-18 5.12 accounting

Clone Sequence Records

LD21957.complete Sequence

1056 bp (1056 high quality bases) assembled on 2002-07-13

GenBank Submission: BT001481

> LD21957.complete
ATGACACCATATTTTAACCATTCTTTTTACTGTTCACGTATCTCAAAAAG
AACAGTTATATTGTAGAGCATCCCTGATATTTCATATATTTATTTACAAT
GGGGAAAACATCAAAGGACAAACGAGATATCTATTACCGACAAGCCAAAG
ACGAAGGCTGGAGGGCCAGGAGTGCCTTCAAGTTGCTCCACGTGGACGAA
GCCTACGGAATTCTAAATGGTGTTCAGCGGGCAGTCGATCTGTGTGCTGC
TCCTGGCAGCTGGTCCCAGGTGCTCTCTCGGAAACTCTACGATACCTGCG
AAACGGACGATGAAAAGTCCGCTGTTAAGATCATAGCCGTTGATCTGCAG
GCCATGGCCCCGATCCGTGGAATACTCCAGCTCCAGGGAGATATCACAAA
GCAGTCGACCGCCGAAGCAATCATCGGTCACTTTGGTGGAAATGAAAAAG
CCCAGCTGGTGGTCTGCGATGGAGCCCCCGATGTCACCGGGGTCCATGAA
ATGGACGAGTACATGCAGCACCAGTTACTTGTGGCTGCTCTCAGCATTGC
CACCTGTGTGCTGGAAACTGGCGGAACTTTTGTGGCCAAGATTTTTAAGG
GAAATGCCACATCGCTATTGAGCTCCCAGATGCAGATATTTTTCAAAAAA
TTCGACATCTACAAGCCACCGAGTTCGCGTCCTTCGAGCATTGAAGCTTT
TGTGGTTTGCTCCGATTTTTGCCTTCCCGAGGGCTACATTCCTCAAGTGA
TTAACCCTGCTCGCGATGATATACGGCTACTGGCACAGAAAACAGGGTCG
GAAGTAAACCGTCGTCTAGTTCCTTTTATAGCCTGTGGAGACTTAAATGG
GTTGAGTGATCCCGAAGAGGGCAAGACTTCCTCCTCAGATGAATCCAAAT
CAAATTTAGAGTATGTTTACGATGCTGTTATGGACGACGCATCTTATCCC
CTGGAATTTAAAGAGATTCTAAAGCAAGTCTATGATGAACAACGCCATAT
TATCTAAATATTTATAAAATAAAACCAAAAAAATTAAAAAAAAAAAAAAA
AAAAAA

LD21957.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:43:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG5220-RA 1183 CG5220-RA 78..1115 1..1038 5190 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12865494..12866177 219..902 3420 100 Plus
chr3R 27901430 chr3R 12865221..12865441 1..221 1105 100 Plus
chr3R 27901430 chr3R 12866235..12866367 903..1035 665 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:10:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17041022..17041705 219..902 3420 100 Plus
3R 32079331 3R 17040749..17040969 1..221 1105 100 Plus
3R 32079331 3R 17041763..17041898 903..1038 680 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:16:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16781853..16782536 219..902 3420 100 Plus
3R 31820162 3R 16781580..16781800 1..221 1105 100 Plus
3R 31820162 3R 16782594..16782729 903..1038 680 100 Plus
Blast to na_te.dros performed 2019-03-15 22:23:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 4219..4325 931..1034 131 62 Plus
Dbuz\ISBu3 993 Dbuz\ISBu3 ISBU3 993bp 258..298 1033..992 117 78.6 Minus

LD21957.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:24:29 Download gff for LD21957.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12865221..12865439 1..219 100 -> Plus
chr3R 12865495..12866177 220..902 100 -> Plus
chr3R 12866235..12866328 903..996 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:57:44 Download gff for LD21957.complete
Subject Subject Range Query Range Percent Splice Strand
CG5220-RA 1..909 99..1007 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:17:14 Download gff for LD21957.complete
Subject Subject Range Query Range Percent Splice Strand
CG5220-RA 1..909 99..1007 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:17:29 Download gff for LD21957.complete
Subject Subject Range Query Range Percent Splice Strand
CG5220-RA 1..909 99..1007 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:08:24 Download gff for LD21957.complete
Subject Subject Range Query Range Percent Splice Strand
CG5220-RA 1..909 99..1007 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:20:17 Download gff for LD21957.complete
Subject Subject Range Query Range Percent Splice Strand
CG5220-RA 1..909 99..1007 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:41:31 Download gff for LD21957.complete
Subject Subject Range Query Range Percent Splice Strand
CG5220-RA 66..1078 1..1013 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:17:13 Download gff for LD21957.complete
Subject Subject Range Query Range Percent Splice Strand
CG5220-RA 66..1078 1..1013 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:17:29 Download gff for LD21957.complete
Subject Subject Range Query Range Percent Splice Strand
CG5220-RA 68..1080 1..1013 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:08:24 Download gff for LD21957.complete
Subject Subject Range Query Range Percent Splice Strand
CG5220-RA 66..1078 1..1013 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:20:17 Download gff for LD21957.complete
Subject Subject Range Query Range Percent Splice Strand
CG5220-RA 68..1080 1..1013 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:24:29 Download gff for LD21957.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17040749..17040967 1..219 100 -> Plus
3R 17041023..17041705 220..902 100 -> Plus
3R 17041763..17041873 903..1013 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:24:29 Download gff for LD21957.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17040749..17040967 1..219 100 -> Plus
3R 17041023..17041705 220..902 100 -> Plus
3R 17041763..17041873 903..1013 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:24:29 Download gff for LD21957.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17040749..17040967 1..219 100 -> Plus
3R 17041023..17041705 220..902 100 -> Plus
3R 17041763..17041873 903..1013 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:17:29 Download gff for LD21957.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12866471..12866689 1..219 100 -> Plus
arm_3R 12866745..12867427 220..902 100 -> Plus
arm_3R 12867485..12867595 903..1013 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:40:22 Download gff for LD21957.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16781580..16781798 1..219 100 -> Plus
3R 16781854..16782536 220..902 100 -> Plus
3R 16782594..16782704 903..1013 100   Plus

LD21957.pep Sequence

Translation from 98 to 1006

> LD21957.pep
MGKTSKDKRDIYYRQAKDEGWRARSAFKLLHVDEAYGILNGVQRAVDLCA
APGSWSQVLSRKLYDTCETDDEKSAVKIIAVDLQAMAPIRGILQLQGDIT
KQSTAEAIIGHFGGNEKAQLVVCDGAPDVTGVHEMDEYMQHQLLVAALSI
ATCVLETGGTFVAKIFKGNATSLLSSQMQIFFKKFDIYKPPSSRPSSIEA
FVVCSDFCLPEGYIPQVINPARDDIRLLAQKTGSEVNRRLVPFIACGDLN
GLSDPEEGKTSSSDESKSNLEYVYDAVMDDASYPLEFKEILKQVYDEQRH
II*

LD21957.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17080-PA 301 GF17080-PA 1..300 1..301 1370 85.5 Plus
Dana\GF23069-PA 405 GF23069-PA 1..211 1..213 706 61.5 Plus
Dana\GF10393-PA 817 GF10393-PA 7..203 1..210 321 37.1 Plus
Dana\GF17621-PA 254 GF17621-PA 48..244 10..207 205 28.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21940-PA 300 GG21940-PA 1..299 1..301 1517 95 Plus
Dere\GG14838-PA 321 GG14838-PA 1..250 1..250 716 56.7 Plus
Dere\GG17939-PA 816 GG17939-PA 7..212 1..219 326 36.1 Plus
Dere\GG23538-PA 250 GG23538-PA 48..244 10..207 206 29.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14141-PA 311 GH14141-PA 1..282 1..284 1098 71.3 Plus
Dgri\GH18555-PA 356 GH18555-PA 1..246 1..245 719 57.6 Plus
Dgri\GH17878-PA 836 GH17878-PA 7..212 1..219 320 36.1 Plus
Dgri\GH16178-PA 249 GH16178-PA 50..246 10..207 185 27.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG5220-PA 302 CG5220-PA 1..302 1..302 1556 100 Plus
CG7009-PA 320 CG7009-PA 1..213 1..215 693 62.8 Plus
CG8939-PA 817 CG8939-PA 7..212 1..219 315 36.1 Plus
CG11447-PA 250 CG11447-PA 48..244 10..207 200 28.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10674-PA 305 GI10674-PA 1..291 1..294 1132 71.6 Plus
Dmoj\GI24754-PA 382 GI24754-PA 1..213 1..215 699 60 Plus
Dmoj\GI16447-PA 826 GI16447-PA 7..212 1..219 326 36.1 Plus
Dmoj\GI22429-PA 254 GI22429-PA 50..246 10..207 188 28.1 Plus
Dmoj\GI16152-PA 1022 GI16152-PA 418..602 47..217 148 27.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24549-PA 304 GL24549-PA 1..290 1..288 1221 80.7 Plus
Dper\GL12002-PA 316 GL12002-PA 1..253 1..251 727 58.4 Plus
Dper\GL12202-PA 249 GL12202-PA 47..243 10..207 201 29.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18746-PA 304 GA18746-PA 1..290 1..288 1221 80.7 Plus
Dpse\GA20027-PA 316 GA20027-PA 1..253 1..251 730 58.8 Plus
Dpse\GA23223-PA 232 GA23223-PA 1..169 86..251 421 54.1 Plus
Dpse\GA11008-PA 249 GA11008-PA 47..243 10..207 201 29.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15199-PA 302 GM15199-PA 1..301 1..301 1553 96.7 Plus
Dsec\GM15097-PA 321 GM15097-PA 1..213 1..215 716 61.9 Plus
Dsec\GM11680-PA 817 GM11680-PA 7..212 1..219 326 36.1 Plus
Dsec\GM26867-PA 250 GM26867-PA 48..244 10..207 204 28.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19132-PA 302 GD19132-PA 1..301 1..301 1555 97 Plus
Dsim\GD17262-PA 204 GD17262-PA 7..182 1..189 273 36.5 Plus
Dsim\GD19317-PA 250 GD19317-PA 48..244 10..207 204 28.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23026-PA 313 GJ23026-PA 1..295 1..295 1195 75.8 Plus
Dvir\GJ22540-PA 316 GJ22540-PA 1..213 1..215 717 63.3 Plus
Dvir\GJ15847-PA 831 GJ15847-PA 7..212 1..219 323 35.6 Plus
Dvir\GJ10992-PA 254 GJ10992-PA 50..249 10..210 178 27.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16249-PA 306 GK16249-PA 1..300 1..298 1178 73.3 Plus
Dwil\GK22383-PA 305 GK22383-PA 1..251 1..251 708 56 Plus
Dwil\GK19748-PA 824 GK19748-PA 7..212 1..219 332 36.1 Plus
Dwil\GK22358-PA 249 GK22358-PA 50..246 10..207 193 28.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:36:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24604-PA 302 GE24604-PA 1..301 1..301 1549 96.3 Plus
Dyak\GE25011-PA 318 GE25011-PA 1..250 1..250 725 56.7 Plus
Dyak\GE17245-PA 819 GE17245-PA 7..212 1..219 328 36.1 Plus
Dyak\GE11211-PA 250 GE11211-PA 48..244 10..207 200 29.5 Plus
Dyak\GE25629-PA 250 GE25629-PA 48..244 10..207 200 29.5 Plus

LD21957.hyp Sequence

Translation from 98 to 1006

> LD21957.hyp
MGKTSKDKRDIYYRQAKDEGWRARSAFKLLHVDEAYGILNGVQRAVDLCA
APGSWSQVLSRKLYDTCETDDEKSAVKIIAVDLQAMAPIRGILQLQGDIT
KQSTAEAIIGHFGGNEKAQLVVCDGAPDVTGVHEMDEYMQHQLLVAALSI
ATCVLETGGTFVAKIFKGNATSLLSSQMQIFFKKFDIYKPPSSRPSSIEA
FVVCSDFCLPEGYIPQVINPARDDIRLLAQKTGSEVNRRLVPFIACGDLN
GLSDPEEGKTSSSDESKSNLEYVYDAVMDDASYPLEFKEILKQVYDEQRH
II*

LD21957.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG5220-PA 302 CG5220-PA 1..302 1..302 1556 100 Plus
CG7009-PA 320 CG7009-PA 1..213 1..215 693 62.8 Plus
CG8939-PA 817 CG8939-PA 7..212 1..219 315 36.1 Plus
CG11447-PA 250 CG11447-PA 48..244 10..207 200 28.8 Plus