Clone LD22317 Report

Search the DGRC for LD22317

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:223
Well:17
Vector:pOT2
Associated Gene/TranscriptGstE13-RA
Protein status:LD22317.pep: gold
Preliminary Size:1300
Sequenced Size:866

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11784 2001-01-01 Release 2 assignment
CG11784 2002-05-16 Blastp of sequenced clone
CG11784 2003-01-01 Sim4 clustering to Release 3
CG11784 2008-04-29 Release 5.5 accounting
CG11784 2008-08-15 Release 5.9 accounting
CG11784 2008-12-18 5.12 accounting

Clone Sequence Records

LD22317.complete Sequence

866 bp (866 high quality bases) assembled on 2002-05-16

GenBank Submission: AY118917

> LD22317.complete
AATGTCGAAGCCAACGCTGTACTACGCCCTTTTTAGTCCTCCTGCCAGGG
CATGCATCCTGGTGGCCAAACTTATTGGACTGGACCTGGAGCTCAAACCC
GTTGACTTCGCCAAGAAGGAACACCTGAGCGAGGAATTTGTCAAGCTAAA
CCCCCAGCACCAGATCCCGGTGTTTGTGGACAGCGATGGCGAGGTCTACG
TGGACAGTCACGCCATCGTGTGCTTCCTGGTAGCCAAGTACGCCGGGAAT
GACCAACTCTATCCGCGGGATTTGAAAAGGAGAGCCCACATCGACCATCG
CATGCACTACGAGAACGGAGTGCTATTTCAGGTGGTAAAGGACATTGTGG
CTCGGAACATTTACGGTGGCGAGGGAGAATACAACCCCCGATCGCTGACC
CTCTGCCACAATGCGTACTCCGACTTGGAACACTTTCTGCAGCAAGGAAG
TTTCGTGGTGGGCAACGAACTGAGCGTTGCCGACGTGTCCATCCACACCA
CTCTGGTGACCTTGGATCTGCTCATACCAGTGGAACGGGAAAAGTACCCG
CAGACTAAGCAATGGATGGAACGCATGGATAAGTTGTTGCCCGACAACGA
GGAGATCAACCTCAAGGGTGCACGGGCTCTGCAGACCCGCATCCTGAGCT
GCATGGCCGAGAACAAAGCGAAGAGCCAGTAGATTCCTTCTTAATGAGGC
TCTCATGTTACACATTCACAGCCAACGTTTTGTGTTCCCCATGTACGCAA
TTCACATTTCAAAACATTTAGACCGCTTGTCAATACTCCAATTTATGTTA
TGCAATAAATACAGAGCCACATAATTTAATTGGAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAA

LD22317.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:07:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG11784-RA 1097 CG11784-RA 264..1097 1..834 4170 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:53:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5010198..5010887 144..833 3450 100 Plus
chr2R 21145070 chr2R 5009931..5010026 1..96 480 100 Plus
chr2R 21145070 chr2R 5010097..5010145 97..145 245 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:11:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:53:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9122620..9123311 144..835 3460 100 Plus
2R 25286936 2R 9122353..9122448 1..96 480 100 Plus
2R 25286936 2R 9122519..9122567 97..145 245 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:35:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9123819..9124510 144..835 3460 100 Plus
2R 25260384 2R 9123552..9123647 1..96 480 100 Plus
2R 25260384 2R 9123718..9123766 97..145 245 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:53:07 has no hits.

LD22317.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:54:40 Download gff for LD22317.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5009931..5010026 1..96 100 -> Plus
chr2R 5010097..5010145 97..145 100 -> Plus
chr2R 5010200..5010887 146..833 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:58:14 Download gff for LD22317.complete
Subject Subject Range Query Range Percent Splice Strand
CG11784-RA 1..681 2..682 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:46:33 Download gff for LD22317.complete
Subject Subject Range Query Range Percent Splice Strand
CG11784-RB 1..681 2..682 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:45:14 Download gff for LD22317.complete
Subject Subject Range Query Range Percent Splice Strand
GstE13-RA 1..681 2..682 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:43:34 Download gff for LD22317.complete
Subject Subject Range Query Range Percent Splice Strand
CG11784-RA 1..681 2..682 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:20:18 Download gff for LD22317.complete
Subject Subject Range Query Range Percent Splice Strand
GstE13-RA 1..681 2..682 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:28:27 Download gff for LD22317.complete
Subject Subject Range Query Range Percent Splice Strand
CG11784-RA 61..893 1..833 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:46:32 Download gff for LD22317.complete
Subject Subject Range Query Range Percent Splice Strand
CG11784-RB 229..1061 1..833 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:45:14 Download gff for LD22317.complete
Subject Subject Range Query Range Percent Splice Strand
GstE13-RA 30..862 1..833 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:43:34 Download gff for LD22317.complete
Subject Subject Range Query Range Percent Splice Strand
CG11784-RA 61..893 1..833 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:20:18 Download gff for LD22317.complete
Subject Subject Range Query Range Percent Splice Strand
GstE13-RA 30..862 1..833 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:54:40 Download gff for LD22317.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9122353..9122448 1..96 100 -> Plus
2R 9122519..9122567 97..145 100 -> Plus
2R 9122622..9123309 146..833 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:54:40 Download gff for LD22317.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9122353..9122448 1..96 100 -> Plus
2R 9122519..9122567 97..145 100 -> Plus
2R 9122622..9123309 146..833 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:54:40 Download gff for LD22317.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9122353..9122448 1..96 100 -> Plus
2R 9122519..9122567 97..145 100 -> Plus
2R 9122622..9123309 146..833 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:45:14 Download gff for LD22317.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5009858..5009953 1..96 100 -> Plus
arm_2R 5010024..5010072 97..145 100 -> Plus
arm_2R 5010127..5010814 146..833 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:11:13 Download gff for LD22317.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9123821..9124508 146..833 100   Plus
2R 9123552..9123647 1..96 100 -> Plus
2R 9123718..9123766 97..145 100 -> Plus

LD22317.hyp Sequence

Translation from 0 to 681

> LD22317.hyp
MSKPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLN
PQHQIPVFVDSDGEVYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHR
MHYENGVLFQVVKDIVARNIYGGEGEYNPRSLTLCHNAYSDLEHFLQQGS
FVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERMDKLLPDNE
EINLKGARALQTRILSCMAENKAKSQ*

LD22317.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:43:14
Subject Length Description Subject Range Query Range Score Percent Strand
GstE13-PB 226 CG11784-PB 1..226 1..226 1178 100 Plus
GstE13-PA 226 CG11784-PA 1..226 1..226 1178 100 Plus
GstE12-PC 223 CG16936-PC 1..223 1..224 436 39.1 Plus
GstE12-PB 223 CG16936-PB 1..223 1..224 436 39.1 Plus
GstE12-PD 223 CG16936-PD 1..223 1..224 436 39.1 Plus

LD22317.pep Sequence

Translation from 1 to 681

> LD22317.pep
MSKPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLN
PQHQIPVFVDSDGEVYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHR
MHYENGVLFQVVKDIVARNIYGGEGEYNPRSLTLCHNAYSDLEHFLQQGS
FVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERMDKLLPDNE
EINLKGARALQTRILSCMAENKAKSQ*

LD22317.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:28:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11958-PA 226 GF11958-PA 1..226 1..226 1018 81 Plus
Dana\GF13293-PA 223 GF13293-PA 1..223 1..224 456 39.6 Plus
Dana\GF11968-PA 972 GF11968-PA 3..197 2..195 418 43.9 Plus
Dana\GF12766-PA 241 GF12766-PA 6..215 6..214 408 42.5 Plus
Dana\GF12168-PA 219 GF12168-PA 1..206 1..208 400 39.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:28:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23416-PA 226 GG23416-PA 1..226 1..226 1152 93.8 Plus
Dere\GG19896-PA 223 GG19896-PA 1..223 1..224 451 39.1 Plus
Dere\GG21901-PA 225 GG21901-PA 3..225 2..224 408 39.6 Plus
Dere\GG21886-PA 222 GG21886-PA 1..206 1..207 403 39.9 Plus
Dere\GG21885-PA 219 GG21885-PA 1..206 1..208 401 39.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:28:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20396-PA 224 GH20396-PA 3..223 2..222 956 77.8 Plus
Dgri\GH21542-PA 224 GH21542-PA 1..222 1..223 462 40.6 Plus
Dgri\GH19714-PA 221 GH19714-PA 3..196 2..195 378 39.5 Plus
Dgri\GH15974-PA 219 GH15974-PA 1..205 1..207 366 37.7 Plus
Dgri\GH21620-PA 238 GH21620-PA 1..212 1..214 366 36.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
GstE13-PB 226 CG11784-PB 1..226 1..226 1178 100 Plus
GstE13-PA 226 CG11784-PA 1..226 1..226 1178 100 Plus
GstE12-PC 223 CG16936-PC 1..223 1..224 436 39.1 Plus
GstE12-PB 223 CG16936-PB 1..223 1..224 436 39.1 Plus
GstE12-PD 223 CG16936-PD 1..223 1..224 436 39.1 Plus
GstE12-PA 223 CG16936-PA 1..223 1..224 436 39.1 Plus
GstE11-PB 225 CG5224-PB 3..225 2..224 409 39.6 Plus
GstE11-PA 225 CG5224-PA 3..225 2..224 409 39.6 Plus
GstE4-PA 222 CG17525-PA 1..206 1..207 387 39.9 Plus
GstE5-PA 222 CG17527-PA 1..215 1..216 380 39.2 Plus
GstE7-PA 223 CG17531-PA 1..213 1..214 379 39.1 Plus
GstE3-PA 220 CG17524-PA 1..207 1..211 373 37.9 Plus
GstE10-PB 240 CG17522-PB 1..216 1..216 371 39 Plus
GstE10-PA 240 CG17522-PA 1..216 1..216 371 39 Plus
GstE2-PA 221 CG17523-PA 4..207 3..208 367 36.9 Plus
GstE6-PA 222 CG17530-PA 1..209 1..210 348 36 Plus
GstE9-PA 221 CG17534-PA 1..209 1..210 343 36 Plus
GstE8-PB 222 CG17533-PB 1..211 1..212 334 37.1 Plus
GstE8-PA 222 CG17533-PA 1..211 1..212 334 37.1 Plus
GstE1-PA 224 CG5164-PA 8..203 6..203 328 35.9 Plus
GstE14-PA 232 CG4688-PA 5..209 3..211 307 33.8 Plus
GstD8-PA 212 CG4421-PA 4..195 7..201 303 33.8 Plus
GstD11-PA 222 CG17639-PA 1..209 1..210 293 34.4 Plus
GstD11-PB 243 CG17639-PB 22..230 1..210 293 34.4 Plus
GstD1-PB 209 CG10045-PB 5..196 7..201 291 33.8 Plus
GstD1-PA 209 CG10045-PA 5..196 7..201 291 33.8 Plus
GstD4-PA 215 CG11512-PA 4..205 7..212 290 34 Plus
GstD5-PA 216 CG12242-PA 4..204 7..211 285 33.8 Plus
GstD9-PB 218 CG10091-PB 5..198 7..201 278 32.7 Plus
GstD9-PA 218 CG10091-PA 5..198 7..201 278 32.7 Plus
GstD7-PA 224 CG4371-PA 6..199 6..201 272 34 Plus
GstD2-PA 215 CG4181-PA 4..204 7..211 271 33.2 Plus
GstD3-PA 199 CG4381-PA 1..191 20..214 263 29.1 Plus
GstD6-PA 215 CG4423-PA 3..195 6..201 260 31.6 Plus
GstD10-PB 210 CG18548-PB 3..196 6..201 248 29.4 Plus
GstD10-PA 210 CG18548-PA 3..196 6..201 248 29.4 Plus
gfzf-PD 234 CG33546-PD 3..206 6..210 216 29.5 Plus
gfzf-PE 1045 CG33546-PE 814..1017 6..210 216 29.5 Plus
gfzf-PB 1045 CG33546-PB 814..1017 6..210 216 29.5 Plus
GstT1-PA 228 CG30000-PA 8..201 7..192 170 26.7 Plus
GstT2-PA 228 CG30005-PA 1..201 1..192 168 26.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:28:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20064-PA 226 GI20064-PA 3..226 2..225 934 78.1 Plus
Dmoj\GI19515-PA 223 GI19515-PA 1..223 1..224 454 39.1 Plus
Dmoj\GI20133-PA 225 GI20133-PA 6..225 1..221 412 40.5 Plus
Dmoj\GI16624-PA 219 GI16624-PA 1..205 1..207 385 37.7 Plus
Dmoj\GI20121-PA 222 GI20121-PA 1..211 1..212 374 38.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:28:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17623-PA 223 GL17623-PA 1..223 1..224 974 78.1 Plus
Dper\GL17702-PA 223 GL17702-PA 1..223 1..224 463 40.9 Plus
Dper\GL17783-PA 226 GL17783-PA 4..224 3..224 399 38.1 Plus
Dper\GL17771-PA 221 GL17771-PA 1..214 1..216 375 39.6 Plus
Dper\GL17769-PA 219 GL17769-PA 1..205 1..207 374 38.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:28:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11198-PA 224 GA11198-PA 1..224 1..224 995 79 Plus
Dpse\GA14226-PA 223 GA14226-PA 1..223 1..224 464 40.4 Plus
Dpse\GA18748-PA 226 GA18748-PA 4..224 3..224 400 38.1 Plus
Dpse\GA14540-PA 219 GA14540-PA 1..205 1..207 374 38.6 Plus
Dpse\GA14542-PA 221 GA14542-PA 1..214 1..216 372 39.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21098-PA 212 GM21098-PA 1..212 1..226 1094 92 Plus
Dsec\GM11796-PA 223 GM11796-PA 1..223 1..224 451 39.6 Plus
Dsec\GM21891-PA 225 GM21891-PA 3..225 2..224 406 39.1 Plus
Dsec\GM21878-PA 219 GM21878-PA 1..206 1..208 400 38.9 Plus
Dsec\GM21876-PA 220 GM21876-PA 1..207 1..211 390 38.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10633-PA 226 GD10633-PA 1..226 1..226 1197 98.2 Plus
Dsim\GD11372-PA 219 GD11372-PA 1..206 1..208 406 39.9 Plus
Dsim\GD24922-PA 213 GD24922-PA 1..213 1..224 396 36.6 Plus
Dsim\GD11373-PA 222 GD11373-PA 1..206 1..207 382 38.9 Plus
Dsim\GD11376-PA 223 GD11376-PA 1..213 1..214 381 38.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14962-PA 277 GJ14962-PA 4..210 3..209 893 76.3 Plus
Dvir\GJ21084-PA 223 GJ21084-PA 1..223 1..224 467 40.4 Plus
Dvir\GJ19903-PA 228 GJ19903-PA 9..201 3..195 408 43.3 Plus
Dvir\GJ12879-PA 219 GJ12879-PA 1..206 1..208 402 38.9 Plus
Dvir\GJ22450-PA 238 GJ22450-PA 10..208 11..210 387 41.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:28:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21654-PA 223 GK21654-PA 1..223 1..224 455 40.4 Plus
Dwil\GK22983-PA 222 GK22983-PA 1..207 1..208 392 37.8 Plus
Dwil\GK22987-PA 219 GK22987-PA 1..206 1..208 381 39.9 Plus
Dwil\GK22985-PA 219 GK22985-PA 1..208 1..210 371 39.5 Plus
Dwil\GK23004-PA 226 GK23004-PA 4..223 3..222 361 37.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:28:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19257-PA 226 GE19257-PA 1..226 1..226 1153 93.8 Plus
Dyak\GE11420-PA 223 GE11420-PA 1..223 1..224 453 39.6 Plus
Dyak\GE11975-PA 225 GE11975-PA 3..225 2..224 407 39.1 Plus
Dyak\GE11960-PA 219 GE11960-PA 1..206 1..208 407 40.4 Plus
Dyak\GE11961-PA 222 GE11961-PA 1..206 1..207 394 39.4 Plus