Clone LD22570 Report

Search the DGRC for LD22570

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:225
Well:70
Vector:pOT2
Associated Gene/TranscriptInx2-RA
Protein status:LD22570.pep: gold
Preliminary Size:2200
Sequenced Size:2316

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4590 2001-01-01 Release 2 assignment
CG4590 2001-07-04 Blastp of sequenced clone
CG4590 2003-01-01 Sim4 clustering to Release 3
inx2 2008-04-29 Release 5.5 accounting
inx2 2008-08-15 Release 5.9 accounting
inx2 2008-12-18 5.12 accounting

Clone Sequence Records

LD22570.complete Sequence

2316 bp (2316 high quality bases) assembled on 2001-07-04

GenBank Submission: AY060368

> LD22570.complete
CCGAAGAGTGCGCTTAGTGCCGCTGCTGCGACGGCGTTTAGACTTCCACC
TGGGTAACCGTCGCCCCCGCCGCCCCCTTGAAACACAAGTGGTTTTGTTT
TTGTTGTCGCGTTGGTGTTGAGAGCGCGAAACGAACTCGAACCGAACAGA
AACGAAGCTCTCTGGGGGATCCAAGCCGAAGATCCAGTGCCCAGCCAAAT
CCCACGTATCGCTGCTCTCGCCGATGGTTACTACTATCTTTTTTTTTCGT
GTGCATTCTTTGAACAGAAACTGAAGAGTAATGGTGGCCAACGAGTGAGG
AACCCGAAAGTCCCGTAGCAAAGTCACCAGGCAGCCGATACGATCCGCAA
CAGTCAGCGTTAGTGTCAAGGAGTAGAAATATCCTCCGTAACAAAGAATC
CTCGCAAATCGCATAATATAGAGTAGCAGACCGACAAAATGTTTGATGTC
TTTGGGTCCGTCAAGGGCCTGCTGAAGATCGACCAGGTGTGCATCGACAA
CAATGTCTTTCGCATGCACTACAAGGCCACGGTGATCATACTGATCGCCT
TCTCCCTCCTGGTGACCTCGCGCCAATACATCGGTGACCCCATCGATTGT
ATTGTGGACGAGATCCCACTGGGCGTGATGGACACCTACTGCTGGATCTA
CTCTACGTTTACCGTGCCAGAGAGGCTAACGGGCATCACCGGACGCGATG
TGGTGCAGCCCGGCGTGGGCTCCCATGTGGAGGGCGAGGACGAGGTGAAG
TACCACAAGTACTACCAGTGGGTGTGCTTCGTCCTCTTCTTCCAGGCCAT
CCTGTTCTACGTACCGCGCTATCTGTGGAAGTCCTGGGAAGGCGGACGCC
TCAAGATGCTGGTCATGGATCTCAACAGCCCTATTGTGAACGATGAGTGC
AAGAACGATCGCAAAAAGATCCTGGTCGACTACTTCATTGGCAACCTGAA
CCGCCACAATTTCTACGCCTTCCGATTCTTCGTGTGCGAAGCCCTGAACT
TTGTGAATGTGATTGGACAGATCTACTTTGTGGACTTCTTCCTCGACGGC
GAGTTCAGCACCTACGGCAGTGATGTCTTGAAGTTCACTGAGCTGGAGCC
GGATGAGCGCATTGATCCCATGGCGCGGGTCTTTCCGAAGGTCACCAAAT
GCACGTTCCACAAATACGGTCCATCCGGCAGTGTGCAGACCCACGACGGT
CTGTGCGTGCTGCCCCTGAACATTGTCAACGAAAAGATCTACGTGTTCCT
GTGGTTCTGGTTCATCATCCTGAGCATCATGTCGGGAATATCGCTTATCT
ACAGAATCGCTGTTGTGGCGGGTCCCAAGCTCCGCCATCTCCTACTCCGA
GCCCGTTCCCGTTTGGCTGAAAGCGAGGAGGTCGAACTGGTGGCCAACAA
GTGCAACATCGGCGATTGGTTCCTGCTCTATCAGCTGGGCAAGAACATCG
ATCCGCTCATCTACAAGGAGGTGATCTCGGACTTGTCCCGCGAAATGAGC
GGCGATGAGCATAGCGCCCACAAGCGGCCCTTCGACGCCTAATTAGTGGG
CGTGGCCGTGTGCCAGAGTGCCATTTCACGCAGCCGAAATTGGGTTAAGA
CGATGATAAGACGATGTCGGAAAATGGGGAAATCAGTAATCGGAAGGCGG
AGGGAGGATAAAGGATAAAGGATTAAGTAAACCAACAATGTAGATGAGGC
CTTTCGAGCTAATGACGAGCTAATGAACACATATCAACGAATTCCATGGT
AAAGGACAAGATCGCAAGCAATAGCCGATTTTACTGTTTACTGTTTTGCA
TCAACAACAAGACACGTACAATTGCAATTAAAAATACAATTACAATAATG
TAACCAACAACAATAATATAACAAATAACAGATACTAGCCGCAGCCAGAA
ACGTTAGCTAAAAGAGTGGATTGGTTTTTTTTGGATTGGATTGGTTCAAC
GGTTTCAAGACAATCAAATTTTCCATTTGCCAAAATTAAGAATTTCCCGA
CTGGACCGAAAATCCCATTGCCAATCCATTTTAAAACATTCCTGGTAATC
TTGAAAGACAGAAGAAAAGACATTTACAAACTATATATTTTTTGTGCAGC
AGCAAACAAATTGAGATATGATAGATCTATATACATCCATATATATTTTT
AATAAGCAATTACATATATATTTATACATAAATATACAGACGGACCGAAA
AGAAATCTATATATTTATGAATGCCACATGCGAGTAACATTTATGCTAAG
AGTTGTGATCATTGATTAAGACATCTAAAAAAAAAATGCGAAAATACAAA
AAAAAAAAAAAAAAAA

LD22570.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
inx2-RA 3197 inx2-RA 163..2471 1..2309 11545 100 Plus
inx2.b 3455 inx2.b 163..2471 1..2309 11545 100 Plus
inx2-RB 2780 inx2-RB 80..2122 267..2309 10215 100 Plus
inx2-RB 2780 inx2-RB 28..80 1..53 265 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:27:09
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6890797..6892369 1..1573 7865 100 Plus
chrX 22417052 chrX 6894879..6895603 1574..2297 3530 99.4 Plus
chrX 22417052 chrX 6866931..6867054 1263..1140 215 78.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:11:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:27:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6998691..7000263 1..1573 7865 100 Plus
X 23542271 X 7002772..7003507 1574..2309 3680 100 Plus
X 23542271 X 6974772..6974895 1263..1140 215 78.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7006789..7008361 1..1573 7865 100 Plus
X 23527363 X 7010870..7011605 1574..2309 3680 100 Plus
X 23527363 X 6982870..6982993 1263..1140 215 78.2 Minus
X 23527363 X 6984120..6984169 796..747 175 90 Minus
Blast to na_te.dros performed 2019-03-16 10:27:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\Vege 884 Dwil\Vege VEGE 884bp Derived from AF518730. 154..281 2232..2104 128 58.5 Minus

LD22570.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:28:11 Download gff for LD22570.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6890797..6892369 1..1573 100 -> Plus
chrX 6894879..6895421 1574..2115 99 == Plus
chrX 6895495..6895580 2189..2274 100 <- Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:58:44 Download gff for LD22570.complete
Subject Subject Range Query Range Percent Splice Strand
inx2-RB 1..1104 439..1542 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:22:25 Download gff for LD22570.complete
Subject Subject Range Query Range Percent Splice Strand
inx2-RC 1..1104 439..1542 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:55:25 Download gff for LD22570.complete
Subject Subject Range Query Range Percent Splice Strand
Inx2-RB 1..1104 439..1542 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:55:05 Download gff for LD22570.complete
Subject Subject Range Query Range Percent Splice Strand
inx2-RB 1..1104 439..1542 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:08:28 Download gff for LD22570.complete
Subject Subject Range Query Range Percent Splice Strand
Inx2-RB 1..1104 439..1542 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:19:42 Download gff for LD22570.complete
Subject Subject Range Query Range Percent Splice Strand
inx2-RA 29..2325 1..2297 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:22:25 Download gff for LD22570.complete
Subject Subject Range Query Range Percent Splice Strand
inx2-RA 29..2325 1..2297 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:55:25 Download gff for LD22570.complete
Subject Subject Range Query Range Percent Splice Strand
Inx2-RA 20..2316 1..2297 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:55:05 Download gff for LD22570.complete
Subject Subject Range Query Range Percent Splice Strand
inx2-RA 29..2325 1..2297 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:08:28 Download gff for LD22570.complete
Subject Subject Range Query Range Percent Splice Strand
Inx2-RA 20..2316 1..2297 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:28:11 Download gff for LD22570.complete
Subject Subject Range Query Range Percent Splice Strand
X 6998691..7000263 1..1573 100 -> Plus
X 7002772..7003495 1574..2297 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:28:11 Download gff for LD22570.complete
Subject Subject Range Query Range Percent Splice Strand
X 6998691..7000263 1..1573 100 -> Plus
X 7002772..7003495 1574..2297 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:28:11 Download gff for LD22570.complete
Subject Subject Range Query Range Percent Splice Strand
X 6998691..7000263 1..1573 100 -> Plus
X 7002772..7003495 1574..2297 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:55:25 Download gff for LD22570.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6892724..6894296 1..1573 100 -> Plus
arm_X 6896805..6897528 1574..2297 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:32:48 Download gff for LD22570.complete
Subject Subject Range Query Range Percent Splice Strand
X 7006789..7008361 1..1573 100 -> Plus
X 7010870..7011593 1574..2297 100   Plus

LD22570.hyp Sequence

Translation from 438 to 1541

> LD22570.hyp
MFDVFGSVKGLLKIDQVCIDNNVFRMHYKATVIILIAFSLLVTSRQYIGD
PIDCIVDEIPLGVMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGE
DEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIV
NDECKNDRKKILVDYFIGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDF
FLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQ
THDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRH
LLLRARSRLAESEEVELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDLS
REMSGDEHSAHKRPFDA*

LD22570.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:43:21
Subject Length Description Subject Range Query Range Score Percent Strand
Inx2-PD 367 CG4590-PD 1..367 1..367 1958 100 Plus
Inx2-PC 367 CG4590-PC 1..367 1..367 1958 100 Plus
Inx2-PB 367 CG4590-PB 1..367 1..367 1958 100 Plus
Inx2-PA 367 CG4590-PA 1..367 1..367 1958 100 Plus
shakB-PA 372 CG34358-PA 1..363 1..364 1039 48.5 Plus

LD22570.pep Sequence

Translation from 438 to 1541

> LD22570.pep
MFDVFGSVKGLLKIDQVCIDNNVFRMHYKATVIILIAFSLLVTSRQYIGD
PIDCIVDEIPLGVMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGE
DEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIV
NDECKNDRKKILVDYFIGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDF
FLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQ
THDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRH
LLLRARSRLAESEEVELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDLS
REMSGDEHSAHKRPFDA*

LD22570.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:47:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20357-PA 367 GF20357-PA 1..367 1..367 1904 97 Plus
Dana\GF20330-PA 362 GF20330-PA 1..362 1..362 991 47.5 Plus
Dana\GF17986-PA 395 GF17986-PA 3..355 1..349 868 45.1 Plus
Dana\GF16006-PA 435 GF16006-PA 36..419 3..349 629 33.2 Plus
Dana\GF20329-PA 440 GF20329-PA 1..378 1..357 618 38.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:47:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19626-PA 367 GG19626-PA 1..367 1..367 1946 99.7 Plus
Dere\GG17645-PA 362 GG17645-PA 1..362 1..362 977 47.2 Plus
Dere\GG17574-PA 372 GG17574-PA 1..363 1..364 957 48.5 Plus
Dere\GG12050-PA 394 GG12050-PA 3..355 1..349 846 45.4 Plus
Dere\GG14053-PA 367 GG14053-PA 1..356 4..354 603 35.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:47:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24686-PA 367 GH24686-PA 1..367 1..367 1831 92.1 Plus
Dgri\GH17771-PA 480 GH17771-PA 109..471 1..364 982 48.8 Plus
Dgri\GH24274-PA 362 GH24274-PA 1..361 1..359 965 46.3 Plus
Dgri\GH19243-PA 394 GH19243-PA 3..355 1..349 861 45.1 Plus
Dgri\GH24223-PA 397 GH24223-PA 1..379 1..351 628 32.5 Plus
Dgri\GH17771-PA 480 GH17771-PA 1..110 14..121 276 50 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Inx2-PD 367 CG4590-PD 1..367 1..367 1958 100 Plus
Inx2-PC 367 CG4590-PC 1..367 1..367 1958 100 Plus
Inx2-PB 367 CG4590-PB 1..367 1..367 1958 100 Plus
Inx2-PA 367 CG4590-PA 1..367 1..367 1958 100 Plus
shakB-PA 372 CG34358-PA 1..363 1..364 1039 48.5 Plus
shakB-PC 361 CG34358-PC 2..352 14..364 999 49.6 Plus
shakB-PH 377 CG34358-PH 18..368 14..364 999 49.6 Plus
shakB-PG 377 CG34358-PG 18..368 14..364 999 49.6 Plus
shakB-PI 377 CG34358-PI 18..368 14..364 999 49.6 Plus
shakB-PD 532 CG34358-PD 173..523 14..364 999 49.6 Plus
ogre-PF 362 CG3039-PF 1..362 1..362 983 47 Plus
ogre-PE 362 CG3039-PE 1..362 1..362 983 47 Plus
ogre-PD 362 CG3039-PD 1..362 1..362 983 47 Plus
ogre-PC 362 CG3039-PC 1..362 1..362 983 47 Plus
ogre-PB 362 CG3039-PB 1..362 1..362 983 47 Plus
ogre-PA 362 CG3039-PA 1..362 1..362 983 47 Plus
Inx3-PC 395 CG1448-PC 3..355 1..349 894 46.2 Plus
Inx3-PB 395 CG1448-PB 3..355 1..349 894 46.2 Plus
Inx3-PA 395 CG1448-PA 3..355 1..349 894 46.2 Plus
shakB-PF 292 CG34358-PF 5..283 85..364 806 49.1 Plus
shakB-PE 316 CG34358-PE 64..307 119..364 725 48.8 Plus
Inx7-PA 438 CG2977-PA 1..379 1..358 675 38.5 Plus
zpg-PB 367 CG10125-PB 1..356 4..354 606 35.8 Plus
zpg-PA 367 CG10125-PA 1..356 4..354 606 35.8 Plus
Inx5-PB 419 CG7537-PB 142..403 89..349 528 36.6 Plus
Inx6-PA 481 CG17063-PA 1..390 4..354 517 29.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:47:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21669-PA 367 GI21669-PA 1..367 1..367 1817 91.8 Plus
Dmoj\GI15107-PA 372 GI15107-PA 1..363 1..364 981 48.8 Plus
Dmoj\GI21582-PA 362 GI21582-PA 1..362 1..362 975 45.9 Plus
Dmoj\GI24278-PA 394 GI24278-PA 3..355 1..349 853 44.8 Plus
Dmoj\GI15723-PA 400 GI15723-PA 1..380 1..349 654 35.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:47:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26820-PA 303 GL26820-PA 1..303 1..367 1429 77.9 Plus
Dper\GL26811-PA 362 GL26811-PA 1..362 1..362 979 47 Plus
Dper\GL23353-PA 395 GL23353-PA 3..359 1..353 842 43.5 Plus
Dper\GL14652-PA 404 GL14652-PA 1..389 1..349 637 33.8 Plus
Dper\GL13242-PA 368 GL13242-PA 1..361 4..358 633 35.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:47:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18281-PA 367 GA18281-PA 1..367 1..367 1891 96.7 Plus
Dpse\GA25656-PA 372 GA25656-PA 1..363 1..364 980 48.5 Plus
Dpse\GA26182-PA 362 GA26182-PA 1..362 1..362 979 47 Plus
Dpse\GA13015-PA 395 GA13015-PA 3..359 1..353 842 43.5 Plus
Dpse\GA20423-PA 404 GA20423-PA 1..389 1..349 636 33.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:47:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17498-PA 367 GM17498-PA 1..367 1..367 1937 99.2 Plus
Dsec\GM17487-PA 362 GM17487-PA 1..362 1..362 963 46.7 Plus
Dsec\GM22657-PA 372 GM22657-PA 1..363 1..364 957 48.5 Plus
Dsec\GM12279-PA 395 GM12279-PA 3..355 1..349 842 45.6 Plus
Dsec\GM17485-PA 434 GM17485-PA 1..379 1..358 608 38.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:47:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16826-PA 347 GD16826-PA 1..347 1..367 1789 93.5 Plus
Dsim\GD16171-PA 362 GD16171-PA 1..362 1..362 963 46.7 Plus
Dsim\GD18012-PA 395 GD18012-PA 3..355 1..349 838 45.4 Plus
Dsim\GD15600-PA 397 GD15600-PA 1..396 1..364 660 32.8 Plus
Dsim\GD16170-PA 434 GD16170-PA 1..379 1..358 610 38.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:47:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15793-PA 367 GJ15793-PA 1..367 1..367 1843 93.5 Plus
Dvir\GJ18913-PA 372 GJ18913-PA 1..363 1..364 981 48.8 Plus
Dvir\GJ15803-PA 362 GJ15803-PA 1..362 1..362 971 46.1 Plus
Dvir\GJ23057-PA 381 GJ23057-PA 3..320 1..315 785 46.7 Plus
Dvir\GJ15253-PA 399 GJ15253-PA 1..382 1..352 650 34.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:47:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25636-PA 367 GK25636-PA 1..367 1..367 1875 95.4 Plus
Dwil\GK25296-PA 362 GK25296-PA 1..362 1..362 964 45.9 Plus
Dwil\GK20049-PA 372 GK20049-PA 1..363 1..364 964 48.8 Plus
Dwil\GK13974-PA 395 GK13974-PA 3..355 1..349 864 45.6 Plus
Dwil\GK25094-PA 368 GK25094-PA 1..352 1..349 674 36.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:47:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15694-PA 367 GE15694-PA 1..367 1..367 1941 99.2 Plus
Dyak\GE17553-PA 362 GE17553-PA 1..362 1..362 972 47 Plus
Dyak\GE15333-PA 372 GE15333-PA 1..363 1..364 957 48.5 Plus
Dyak\GE10490-PA 395 GE10490-PA 3..355 1..349 841 45.1 Plus
Dyak\GE17551-PA 444 GE17551-PA 1..379 1..358 608 38.5 Plus