Clone LD23561 Report

Search the DGRC for LD23561

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:235
Well:61
Vector:pOT2
Associated Gene/TranscriptCG5854-RA
Protein status:LD23561.pep: gold
Preliminary Size:1300
Sequenced Size:1565

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5854 2001-01-01 Release 2 assignment
CG5854 2003-02-17 Blastp of sequenced clone
CG5854 2008-04-29 Release 5.5 accounting
CG5854 2008-08-15 Release 5.9 accounting
CG5854 2008-12-18 5.12 accounting

Clone Sequence Records

LD23561.complete Sequence

1565 bp (1565 high quality bases) assembled on 2003-02-17

GenBank Submission: BT004487

> LD23561.complete
CCAAACAAAACAACAAAAAGCATTTCGAGCGCTAACAAATATATATCTTT
CGACTTGACTCATTCGCATTCCGGTTGACCGTGTCGCGCCTGCAGCATGT
CTGAAAAGCCGACTGTTCTGATTTTGGGTGGCTGCGGCTTCATTGGACGC
AACTTGGCCACTTATCTGCTGGACAATGAACTGGCGCAGGAAATACGACT
GGCCGATAAGACCCCTCCGCAGATGGCATGGCTAAACGAGGAGCAGACGC
GGGTCTTCGAGAGCGATCGGGTGGAGTTCTGCAGCGCGAACCTAATAAAC
GCCGCCTCATGCAAGGCGGCTTTTGCGCCACACCCCACCACTGGACGGGC
CTGGGACATTGTCATCAATTGTGCGGCCGAGACGCGTGCCAACCAGGATG
ATGCCGTATACAAGGAGGGTATCCTGAAGCTCAGTTTGAACTGCGCCAAT
GAGGCGGCTAACCAGCGGGTCAAACGATACGTGGAACTCAGCTCTGGTTG
TGTGAACAGCAGCGAAAAGACGCCGTTAAAAGAGGACTGCAAGACGGATC
CCTGGACGGGCGTGGCCAAGCAGAAGCTCAAGGTGGAGAAGGAACTGGCC
AACATCGACGATCTCAGTTACACGGTCGTCCGTTTGCCCGTGGTCTATGG
CATTGGCGATAAGCGCTATTTGATGCCGCGCATTATAATCGCTGCCATAT
ACAAATACCTGAACGAGACAATGAAGCTGCTGTGGAACGATGCCATGCGT
TTGAATACTGTGCACGTATCGGACGTGTGCGCTGCCGTTTGGCAATTGGC
TCAGAGTCCCAAGACCGCCGGTCAGATCTACAACATCTGCGATGATTCAG
CATCGACGCAGGGCACCATTAGTAATCTTTTAGTGGATATTTTCGACATC
AATTTGGATTTCTTCGGCCTTGTAATGTCGAATTTGGCAAAACTTTATCC
CACGGACACCGTCAGTGAAATCAACGACAAGCACATGGCACCCTGGGCCG
AGATTTGCCAGCGCAATGGCATCGACAACACCCCGCTGACACCGTACCTA
GATGAGGAGCAGCTCCAGCACAAGCACCTCTACTTGGATAACACGAAACT
GAAAGACTTTGGCTACGTGCTGCAGCATCCGAAAGTCACTCGCGAGCTGC
TCATGGAGATGATTAACGACTATGTGAAGCAGCAATTGTTTCCGAAATCG
TTGGTTCTTTGATTCACTACTTCTATCAAAAGATTGCACCACGTTGACAT
GCACTCGGACCCGGAGACATTTATTCCCTGTAGCTTGTAATCCACTAGTT
TTTTAAACGATTATCAAACCTCTTCCAATTTGTATACGGACACGGATACT
CTCACATGCACGCTGTGCTGTATCTCCGTTTTTTTTAATCACAAAAGTGT
ACTTATAGTATTATAGAACCCATATATTTTTGATACATTCCAGTCGATCC
AGCGATATATACGTTTTTGCGTACGAGTATTCCATTGTGATTAGCTAAGT
GACCAACCGCAATCGACAATTAAAATGCACTTGTTTAGAGTTTAAAAAAA
AAAAAAAAAAAAAAA

LD23561.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:20:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG5854.a 2118 CG5854.a 122..1665 1..1544 7720 100 Plus
CG5854-RA 1706 CG5854-RA 122..1665 1..1544 7720 100 Plus
CG5854-RB 1732 CG5854-RB 277..1691 130..1544 7075 100 Plus
CG5854-RB 1732 CG5854-RB 38..168 1..131 655 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:33:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19758793..19759394 943..1543 2960 99.8 Plus
chr3R 27901430 chr3R 19757992..19758361 304..673 1805 99.2 Plus
chr3R 27901430 chr3R 19758458..19758726 674..942 1345 100 Plus
chr3R 27901430 chr3R 19757599..19757773 130..304 875 100 Plus
chr3R 27901430 chr3R 19757360..19757490 1..131 655 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:13:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:33:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23935364..23935965 943..1544 3010 100 Plus
3R 32079331 3R 23934563..23934932 304..673 1850 100 Plus
3R 32079331 3R 23935029..23935297 674..942 1345 100 Plus
3R 32079331 3R 23934170..23934344 130..304 875 100 Plus
3R 32079331 3R 23933931..23934061 1..131 655 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:58:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23676195..23676796 943..1544 3010 100 Plus
3R 31820162 3R 23675394..23675763 304..673 1850 100 Plus
3R 31820162 3R 23675860..23676128 674..942 1345 100 Plus
3R 31820162 3R 23675001..23675175 130..304 875 100 Plus
3R 31820162 3R 23674762..23674892 1..131 655 100 Plus
Blast to na_te.dros performed on 2019-03-16 10:33:41 has no hits.

LD23561.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:34:20 Download gff for LD23561.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19757360..19757489 1..130 100 -> Plus
chr3R 19757600..19757773 131..304 100 -> Plus
chr3R 19757993..19758361 305..673 99 -> Plus
chr3R 19758458..19758726 674..942 100 -> Plus
chr3R 19758793..19759394 943..1543 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:00:19 Download gff for LD23561.complete
Subject Subject Range Query Range Percent Splice Strand
CG5854-RA 1..1116 97..1212 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:50:05 Download gff for LD23561.complete
Subject Subject Range Query Range Percent Splice Strand
CG5854-RA 1..1116 97..1212 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:56:46 Download gff for LD23561.complete
Subject Subject Range Query Range Percent Splice Strand
CG5854-RA 1..1116 97..1212 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:41:20 Download gff for LD23561.complete
Subject Subject Range Query Range Percent Splice Strand
CG5854-RA 1..1116 97..1212 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:12:22 Download gff for LD23561.complete
Subject Subject Range Query Range Percent Splice Strand
CG5854-RA 1..1116 97..1212 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:03:02 Download gff for LD23561.complete
Subject Subject Range Query Range Percent Splice Strand
CG5854-RA 17..1559 1..1543 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:50:05 Download gff for LD23561.complete
Subject Subject Range Query Range Percent Splice Strand
CG5854-RA 17..1559 1..1543 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:56:46 Download gff for LD23561.complete
Subject Subject Range Query Range Percent Splice Strand
CG5854-RA 20..1562 1..1543 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:41:20 Download gff for LD23561.complete
Subject Subject Range Query Range Percent Splice Strand
CG5854-RA 17..1559 1..1543 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:12:22 Download gff for LD23561.complete
Subject Subject Range Query Range Percent Splice Strand
CG5854-RA 20..1562 1..1543 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:34:20 Download gff for LD23561.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23934564..23934932 305..673 100 -> Plus
3R 23935029..23935297 674..942 100 -> Plus
3R 23933931..23934060 1..130 100 -> Plus
3R 23934171..23934344 131..304 100 -> Plus
3R 23935364..23935964 943..1543 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:34:20 Download gff for LD23561.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23934564..23934932 305..673 100 -> Plus
3R 23935029..23935297 674..942 100 -> Plus
3R 23933931..23934060 1..130 100 -> Plus
3R 23934171..23934344 131..304 100 -> Plus
3R 23935364..23935964 943..1543 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:34:20 Download gff for LD23561.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23934564..23934932 305..673 100 -> Plus
3R 23935029..23935297 674..942 100 -> Plus
3R 23933931..23934060 1..130 100 -> Plus
3R 23934171..23934344 131..304 100 -> Plus
3R 23935364..23935964 943..1543 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:56:46 Download gff for LD23561.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19759893..19760066 131..304 100 -> Plus
arm_3R 19759653..19759782 1..130 100 -> Plus
arm_3R 19760286..19760654 305..673 100 -> Plus
arm_3R 19760751..19761019 674..942 100 -> Plus
arm_3R 19761086..19761686 943..1543 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:11:52 Download gff for LD23561.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23675395..23675763 305..673 100 -> Plus
3R 23675860..23676128 674..942 100 -> Plus
3R 23676195..23676795 943..1543 100   Plus
3R 23674762..23674891 1..130 100 -> Plus
3R 23675002..23675175 131..304 100 -> Plus

LD23561.pep Sequence

Translation from 96 to 1211

> LD23561.pep
MSEKPTVLILGGCGFIGRNLATYLLDNELAQEIRLADKTPPQMAWLNEEQ
TRVFESDRVEFCSANLINAASCKAAFAPHPTTGRAWDIVINCAAETRANQ
DDAVYKEGILKLSLNCANEAANQRVKRYVELSSGCVNSSEKTPLKEDCKT
DPWTGVAKQKLKVEKELANIDDLSYTVVRLPVVYGIGDKRYLMPRIIIAA
IYKYLNETMKLLWNDAMRLNTVHVSDVCAAVWQLAQSPKTAGQIYNICDD
SASTQGTISNLLVDIFDINLDFFGLVMSNLAKLYPTDTVSEINDKHMAPW
AEICQRNGIDNTPLTPYLDEEQLQHKHLYLDNTKLKDFGYVLQHPKVTRE
LLMEMINDYVKQQLFPKSLVL*

LD23561.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:49:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17025-PA 371 GF17025-PA 1..371 1..371 1894 92.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:49:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11238-PA 371 GG11238-PA 1..371 1..371 1985 98.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:49:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21196-PA 372 GH21196-PA 1..372 1..371 1762 85.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG5854-PA 371 CG5854-PA 1..371 1..371 1944 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10482-PA 371 GI10482-PA 1..371 1..371 1763 85.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23381-PA 371 GL23381-PA 1..371 1..371 1813 88.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19181-PA 371 GA19181-PA 1..371 1..371 1817 88.7 Plus
Dpse\GA19181-PB 329 GA19181-PB 1..329 43..371 1605 88.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26540-PA 371 GM26540-PA 1..371 1..371 1990 99.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21047-PA 371 GD21047-PA 1..371 1..371 1995 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23163-PA 371 GJ23163-PA 1..371 1..371 1790 86.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11485-PA 369 GK11485-PA 1..369 1..371 1769 85.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23430-PA 371 GE23430-PA 1..371 1..371 1986 99.2 Plus

LD23561.hyp Sequence

Translation from 96 to 1211

> LD23561.hyp
MSEKPTVLILGGCGFIGRNLATYLLDNELAQEIRLADKTPPQMAWLNEEQ
TRVFESDRVEFCSANLINAASCKAAFAPHPTTGRAWDIVINCAAETRANQ
DDAVYKEGILKLSLNCANEAANQRVKRYVELSSGCVNSSEKTPLKEDCKT
DPWTGVAKQKLKVEKELANIDDLSYTVVRLPVVYGIGDKRYLMPRIIIAA
IYKYLNETMKLLWNDAMRLNTVHVSDVCAAVWQLAQSPKTAGQIYNICDD
SASTQGTISNLLVDIFDINLDFFGLVMSNLAKLYPTDTVSEINDKHMAPW
AEICQRNGIDNTPLTPYLDEEQLQHKHLYLDNTKLKDFGYVLQHPKVTRE
LLMEMINDYVKQQLFPKSLVL*

LD23561.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG5854-PA 371 CG5854-PA 1..371 1..371 1944 100 Plus