Clone LD23604 Report

Search the DGRC for LD23604

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:236
Well:4
Vector:pOT2
Associated Gene/TranscriptCG6540-RA
Protein status:LD23604.pep: gold
Preliminary Size:1300
Sequenced Size:1211

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6540 2001-01-01 Release 2 assignment
CG6540 2003-01-01 Sim4 clustering to Release 3
CG6540 2003-01-15 Blastp of sequenced clone
CG6540 2008-04-29 Release 5.5 accounting
CG6540 2008-08-15 Release 5.9 accounting
CG6540 2008-12-18 5.12 accounting

Clone Sequence Records

LD23604.complete Sequence

1211 bp (1211 high quality bases) assembled on 2003-01-15

GenBank Submission: AY061318

> LD23604.complete
TCCTTGTTAATGCAACGCTTTTTCGTTTTTCGCCGTTATAATTATTATAA
TTAATATTCGCATTCGATATGGAGCCAATGAATCTGGGCAGCCCGGTCAA
CAGTCCTGGCTCCAACCAGACCCAGTATCTGCCACCTTTTCTGCTCGGCG
ATCCGCAAGGTATAACGCCGCACAAGAACACGCTGTCCCCGAAAACCGGG
CGCTCTAATATAAGTTTCGCCACCTCGCCCGGCGGCAGCAGTCCGCACGA
GCTCAACCGCTCCGCTCTGAGCACACGCACTCTGTTCGCCGCCCAAGGAG
GCGCCCACACGGCTGTGGGCGCCAACAGCTCAACGACCGCGCACGGCCAG
ACGCACAGCCACCACCAGACGGGACCGCCCACCCAGGGACTCTTCGACTC
GCTGCGCGAACAGTCCGTCACCCCGAAGAAGAAGAACCATCTTGGCATGC
TGCAGTTGCAGTCACCGAACCAGAGCTACCAGAGCAGCTATCACACGAAT
GACTCGTTCGCACCCGGGGCGCCCAATGCCATCAATGCCTCGATGCGAGC
ACTGTGCTCGCCACTTGGAGCCACTGCCTCGCCAGCTGGAGGCCTGGGCA
CATCCGTGACGACGGGCGGCAACTCGCGCCTATCCGACTTTTGGGTTACC
ATCTTCGGGTTCCCGCCGGGGGCCGGCTCCATGGTGCTGCAGCACTTCAC
CGTCTGCGGCACCATTGTGGACGTGGTGCATGCCCCGCAGAACGGCAACT
GGATGTATGTGCGCTACTCCTCGCGCATCGAGAGCGACAAGGCGCTGAAC
TACAACGAAAAAATCATCGCCGGCAATGTGATGGTGGGCGTGTCGCGCTG
CACGGATAGGTCGGTGATCGATAAGGAGAACATCGGCTCTGTGCCCAATG
CAGAGATAGGAGATCCCCCCACCAGCCCCAGTGCGATTCGACCGTTTTCC
CAGCAGTCGTACAAGCTGGCCCGCAAAGATAACATCATATCGCCGCAGAA
GGATGTGCCGCAAAAGAGCTCCGGTCTGATGGACAAGGCCATGGACCTGA
TATTCGGCTGGTAAGAAGGGCTGATGGCAAGTCGGATGGATGGATAGATG
GAGTGATGGAGTTTCCGGCTACTTATTTAATAATTCACTGCCTACATCCA
GCATACATACATATACATACTTATTAAATGGAGATATATTAGCAAAAAAA
AAAAAAAAAAA

LD23604.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG6540-RA 1301 CG6540-RA 63..1257 1..1195 5975 100 Plus
CG6617-RA 1137 CG6617-RA 1001..1137 1195..1059 685 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:40:59
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18537682..18538656 219..1193 4875 100 Plus
chrX 22417052 chrX 18537405..18537623 1..219 1095 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:13:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:40:57
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18648515..18649491 219..1195 4885 100 Plus
X 23542271 X 18648238..18648456 1..219 1095 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:03:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18656613..18657589 219..1195 4885 100 Plus
X 23527363 X 18656336..18656554 1..219 1095 100 Plus
Blast to na_te.dros performed 2019-03-16 09:40:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Paris 1730 Dvir\Paris TV1 1730bp Derived from Z49253. 74..137 7..70 122 65.6 Plus
Dvir\Paris 1730 Dvir\Paris TV1 1730bp Derived from Z49253. 1594..1657 70..7 122 65.6 Minus

LD23604.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:41:40 Download gff for LD23604.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18537683..18538656 220..1193 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:00:26 Download gff for LD23604.complete
Subject Subject Range Query Range Percent Splice Strand
CG6540-RA 1..996 69..1064 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:56:15 Download gff for LD23604.complete
Subject Subject Range Query Range Percent Splice Strand
CG6540-RA 1..996 69..1064 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:03:58 Download gff for LD23604.complete
Subject Subject Range Query Range Percent Splice Strand
CG6540-RA 1..996 69..1064 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:47:10 Download gff for LD23604.complete
Subject Subject Range Query Range Percent Splice Strand
CG6540-RA 1..996 69..1064 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:16:46 Download gff for LD23604.complete
Subject Subject Range Query Range Percent Splice Strand
CG6540-RA 1..996 69..1064 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:11:55 Download gff for LD23604.complete
Subject Subject Range Query Range Percent Splice Strand
CG6540-RA 52..1244 1..1193 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:56:15 Download gff for LD23604.complete
Subject Subject Range Query Range Percent Splice Strand
CG6540-RA 52..1244 1..1193 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:03:58 Download gff for LD23604.complete
Subject Subject Range Query Range Percent Splice Strand
CG6540-RA 57..1249 1..1193 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:47:10 Download gff for LD23604.complete
Subject Subject Range Query Range Percent Splice Strand
CG6540-RA 52..1244 1..1193 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:16:46 Download gff for LD23604.complete
Subject Subject Range Query Range Percent Splice Strand
CG6540-RA 57..1249 1..1193 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:41:40 Download gff for LD23604.complete
Subject Subject Range Query Range Percent Splice Strand
X 18648238..18648456 1..219 100 -> Plus
X 18648516..18649489 220..1193 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:41:40 Download gff for LD23604.complete
Subject Subject Range Query Range Percent Splice Strand
X 18648238..18648456 1..219 100 -> Plus
X 18648516..18649489 220..1193 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:41:40 Download gff for LD23604.complete
Subject Subject Range Query Range Percent Splice Strand
X 18648238..18648456 1..219 100 -> Plus
X 18648516..18649489 220..1193 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:03:58 Download gff for LD23604.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18542271..18542489 1..219 100 -> Plus
arm_X 18542549..18543522 220..1193 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:18:25 Download gff for LD23604.complete
Subject Subject Range Query Range Percent Splice Strand
X 18656336..18656554 1..219 100 -> Plus
X 18656614..18657587 220..1193 100   Plus

LD23604.hyp Sequence

Translation from 68 to 1063

> LD23604.hyp
MEPMNLGSPVNSPGSNQTQYLPPFLLGDPQGITPHKNTLSPKTGRSNISF
ATSPGGSSPHELNRSALSTRTLFAAQGGAHTAVGANSSTTAHGQTHSHHQ
TGPPTQGLFDSLREQSVTPKKKNHLGMLQLQSPNQSYQSSYHTNDSFAPG
APNAINASMRALCSPLGATASPAGGLGTSVTTGGNSRLSDFWVTIFGFPP
GAGSMVLQHFTVCGTIVDVVHAPQNGNWMYVRYSSRIESDKALNYNEKII
AGNVMVGVSRCTDRSVIDKENIGSVPNAEIGDPPTSPSAIRPFSQQSYKL
ARKDNIISPQKDVPQKSSGLMDKAMDLIFGW*

LD23604.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:23:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG6540-PA 331 CG6540-PA 1..331 1..331 1746 100 Plus

LD23604.pep Sequence

Translation from 68 to 1063

> LD23604.pep
MEPMNLGSPVNSPGSNQTQYLPPFLLGDPQGITPHKNTLSPKTGRSNISF
ATSPGGSSPHELNRSALSTRTLFAAQGGAHTAVGANSSTTAHGQTHSHHQ
TGPPTQGLFDSLREQSVTPKKKNHLGMLQLQSPNQSYQSSYHTNDSFAPG
APNAINASMRALCSPLGATASPAGGLGTSVTTGGNSRLSDFWVTIFGFPP
GAGSMVLQHFTVCGTIVDVVHAPQNGNWMYVRYSSRIESDKALNYNEKII
AGNVMVGVSRCTDRSVIDKENIGSVPNAEIGDPPTSPSAIRPFSQQSYKL
ARKDNIISPQKDVPQKSSGLMDKAMDLIFGW*

LD23604.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22540-PA 341 GF22540-PA 1..341 1..331 1124 66.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19177-PA 330 GG19177-PA 1..330 1..331 1407 79 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11910-PA 340 GH11910-PA 1..340 1..331 908 54 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
Nup35-PA 331 CG6540-PA 1..331 1..331 1746 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:35:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15516-PA 336 GI15516-PA 1..336 1..331 996 59.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:35:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26988-PA 330 GL26988-PA 1..330 1..331 946 59.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:35:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19671-PA 330 GA19671-PA 1..330 1..331 933 58.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:35:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22908-PA 336 GM22908-PA 1..336 1..331 1584 88.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:35:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24856-PA 336 GD24856-PA 1..336 1..331 1547 86.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:35:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19275-PA 331 GJ19275-PA 1..331 1..331 995 60.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:35:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24952-PA 362 GK24952-PA 1..362 1..331 914 56.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:35:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17741-PA 338 GE17741-PA 1..338 1..331 1452 80.5 Plus