Clone LD23674 Report

Search the DGRC for LD23674

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:236
Well:74
Vector:pOT2
Associated Gene/TranscriptRpS28b-RA
Protein status:LD23674.pep: gold
Preliminary Size:494
Sequenced Size:518

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2998 2001-01-01 Release 2 assignment
CG2998 2001-10-10 Blastp of sequenced clone
CG2998 2003-01-01 Sim4 clustering to Release 3
RpS28b 2008-04-29 Release 5.5 accounting
RpS28b 2008-08-15 Release 5.9 accounting
RpS28b 2008-12-18 5.12 accounting

Clone Sequence Records

LD23674.complete Sequence

518 bp (518 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061320

> LD23674.complete
TCAATTGAAGCGCATCTTGCACGTGAATTCTCTGCGAATTTAGCATTTTT
AGCGATCTAACATGGACAAACCAGTTGTGTGGGCACGCGTCATGAAGGTT
CTGGGCCGCACCGGCTCCCAGGGTCAGTGTACCCAGGTGAAGGTCGAGTT
CCTGGGCGAGCAGAACCGCCAGATTATCCGAAACGTGAAGGGACCAGTTC
GCGAGGGCGACATCCTGACCCTTTTGGAATCCGAACGTGAAGCCAGGAGG
CTGCGCTAATTGGCGACCAAACTCGAGAAGACCTTTTTACACACACATAC
ACAAAACTGTTTTTCGCACGCGCCTTGTTTTTTTCGCGGAGAAGAAGAAG
CGGATGGCAAGAAATCCGAACGAGGCTGCTGCATATTCGTTATAAACAAA
TGAAAATACACACCTAATTCGCCAGAAAATCAGCAAAAATGTGTTTTAAA
TAAATCTCGAGAGCATTGGACCGCCTTTGTACGAAAAGAAAACCAAAAAA
AAAAAAAAAAAAAAAAAA

LD23674.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
RpS28b-RA 999 RpS28b-RA 116..611 1..496 2480 100 Plus
RpS28a-RA 195 RpS28a-RA 43..193 107..257 335 81.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 9446362..9446641 1..280 1400 100 Plus
chrX 22417052 chrX 9446707..9446922 279..494 1080 100 Plus
chr3R 27901430 chr3R 25844821..25844971 257..107 335 81.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:13:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9554649..9554928 1..280 1400 100 Plus
X 23542271 X 9554994..9555211 279..496 1090 100 Plus
3R 32079331 3R 30022406..30022556 257..107 335 81.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 9562747..9563026 1..280 1400 100 Plus
X 23527363 X 9563092..9563309 279..496 1090 100 Plus
3R 31820162 3R 29763237..29763387 257..107 335 81.4 Minus
Blast to na_te.dros performed on 2019-03-16 09:42:27 has no hits.

LD23674.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:43:21 Download gff for LD23674.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 9446362..9446641 1..280 100 -> Plus
chrX 9446709..9446922 281..494 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:00:45 Download gff for LD23674.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 1..198 62..259 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:36:02 Download gff for LD23674.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 1..198 62..259 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:04:24 Download gff for LD23674.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 1..198 62..259 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:04:54 Download gff for LD23674.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 1..198 62..259 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:17:39 Download gff for LD23674.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 1..198 62..259 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:16:08 Download gff for LD23674.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 31..524 1..494 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:36:02 Download gff for LD23674.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 28..521 1..494 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:04:24 Download gff for LD23674.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 27..520 1..494 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:04:54 Download gff for LD23674.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 31..524 1..494 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:17:39 Download gff for LD23674.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 27..520 1..494 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:43:21 Download gff for LD23674.complete
Subject Subject Range Query Range Percent Splice Strand
X 9554649..9554928 1..280 100 -> Plus
X 9554996..9555209 281..494 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:43:21 Download gff for LD23674.complete
Subject Subject Range Query Range Percent Splice Strand
X 9554649..9554928 1..280 100 -> Plus
X 9554996..9555209 281..494 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:43:21 Download gff for LD23674.complete
Subject Subject Range Query Range Percent Splice Strand
X 9554649..9554928 1..280 100 -> Plus
X 9554996..9555209 281..494 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:04:24 Download gff for LD23674.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9448682..9448961 1..280 100 -> Plus
arm_X 9449029..9449242 281..494 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:40:44 Download gff for LD23674.complete
Subject Subject Range Query Range Percent Splice Strand
X 9562747..9563026 1..280 100 -> Plus
X 9563094..9563307 281..494 100   Plus

LD23674.hyp Sequence

Translation from 61 to 258

> LD23674.hyp
MDKPVVWARVMKVLGRTGSQGQCTQVKVEFLGEQNRQIIRNVKGPVREGD
ILTLLESEREARRLR*

LD23674.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:22:21
Subject Length Description Subject Range Query Range Score Percent Strand
RpS28b-PB 65 CG2998-PB 1..65 1..65 329 100 Plus
RpS28b-PA 65 CG2998-PA 1..65 1..65 329 100 Plus
RpS28a-PA 64 CG15527-PA 1..64 1..65 264 81.5 Plus

LD23674.pep Sequence

Translation from 61 to 258

> LD23674.pep
MDKPVVWARVMKVLGRTGSQGQCTQVKVEFLGEQNRQIIRNVKGPVREGD
ILTLLESEREARRLR*

LD23674.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21783-PA 55 GF21783-PA 1..55 1..65 258 84.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18316-PA 65 GG18316-PA 1..65 1..65 328 100 Plus
Dere\GG11974-PA 64 GG11974-PA 1..64 1..65 268 81.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12901-PA 65 GH12901-PA 1..65 1..65 328 100 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
RpS28b-PB 65 CG2998-PB 1..65 1..65 329 100 Plus
RpS28b-PA 65 CG2998-PA 1..65 1..65 329 100 Plus
RpS28a-PA 64 CG15527-PA 1..64 1..65 264 81.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14378-PA 65 GI14378-PA 1..65 1..65 328 100 Plus
Dmoj\GI17640-PA 65 GI17640-PA 1..54 1..54 132 50 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15566-PA 65 GA15566-PA 1..65 1..65 328 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11375-PA 65 GM11375-PA 1..65 1..65 328 100 Plus
Dsec\GM12191-PA 136 GM12191-PA 78..136 7..65 251 81.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16052-PA 65 GD16052-PA 1..65 1..65 328 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19416-PA 65 GJ19416-PA 1..65 1..65 328 100 Plus
Dvir\GJ18205-PA 65 GJ18205-PA 1..57 1..57 131 49.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25380-PA 65 GK25380-PA 1..65 1..65 328 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17798-PA 65 GE17798-PA 1..65 1..65 328 100 Plus
Dyak\GE23424-PA 64 GE23424-PA 1..64 1..65 280 86.2 Plus