BDGP Sequence Production Resources |
Search the DGRC for LD23674
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 236 |
Well: | 74 |
Vector: | pOT2 |
Associated Gene/Transcript | RpS28b-RA |
Protein status: | LD23674.pep: gold |
Preliminary Size: | 494 |
Sequenced Size: | 518 |
Gene | Date | Evidence |
---|---|---|
CG2998 | 2001-01-01 | Release 2 assignment |
CG2998 | 2001-10-10 | Blastp of sequenced clone |
CG2998 | 2003-01-01 | Sim4 clustering to Release 3 |
RpS28b | 2008-04-29 | Release 5.5 accounting |
RpS28b | 2008-08-15 | Release 5.9 accounting |
RpS28b | 2008-12-18 | 5.12 accounting |
518 bp (518 high quality bases) assembled on 2001-10-10
GenBank Submission: AY061320
> LD23674.complete TCAATTGAAGCGCATCTTGCACGTGAATTCTCTGCGAATTTAGCATTTTT AGCGATCTAACATGGACAAACCAGTTGTGTGGGCACGCGTCATGAAGGTT CTGGGCCGCACCGGCTCCCAGGGTCAGTGTACCCAGGTGAAGGTCGAGTT CCTGGGCGAGCAGAACCGCCAGATTATCCGAAACGTGAAGGGACCAGTTC GCGAGGGCGACATCCTGACCCTTTTGGAATCCGAACGTGAAGCCAGGAGG CTGCGCTAATTGGCGACCAAACTCGAGAAGACCTTTTTACACACACATAC ACAAAACTGTTTTTCGCACGCGCCTTGTTTTTTTCGCGGAGAAGAAGAAG CGGATGGCAAGAAATCCGAACGAGGCTGCTGCATATTCGTTATAAACAAA TGAAAATACACACCTAATTCGCCAGAAAATCAGCAAAAATGTGTTTTAAA TAAATCTCGAGAGCATTGGACCGCCTTTGTACGAAAAGAAAACCAAAAAA AAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 9446362..9446641 | 1..280 | 1400 | 100 | Plus |
chrX | 22417052 | chrX | 9446707..9446922 | 279..494 | 1080 | 100 | Plus |
chr3R | 27901430 | chr3R | 25844821..25844971 | 257..107 | 335 | 81.5 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 9446362..9446641 | 1..280 | 100 | -> | Plus |
chrX | 9446709..9446922 | 281..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS28b-RA | 1..198 | 62..259 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS28b-RA | 1..198 | 62..259 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS28b-RA | 1..198 | 62..259 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS28b-RA | 1..198 | 62..259 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS28b-RA | 1..198 | 62..259 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS28b-RA | 31..524 | 1..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS28b-RA | 28..521 | 1..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS28b-RA | 27..520 | 1..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS28b-RA | 31..524 | 1..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS28b-RA | 27..520 | 1..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 9554649..9554928 | 1..280 | 100 | -> | Plus |
X | 9554996..9555209 | 281..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 9554649..9554928 | 1..280 | 100 | -> | Plus |
X | 9554996..9555209 | 281..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 9554649..9554928 | 1..280 | 100 | -> | Plus |
X | 9554996..9555209 | 281..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 9448682..9448961 | 1..280 | 100 | -> | Plus |
arm_X | 9449029..9449242 | 281..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 9562747..9563026 | 1..280 | 100 | -> | Plus |
X | 9563094..9563307 | 281..494 | 100 | Plus |
Translation from 61 to 258
> LD23674.hyp MDKPVVWARVMKVLGRTGSQGQCTQVKVEFLGEQNRQIIRNVKGPVREGD ILTLLESEREARRLR*
Translation from 61 to 258
> LD23674.pep MDKPVVWARVMKVLGRTGSQGQCTQVKVEFLGEQNRQIIRNVKGPVREGD ILTLLESEREARRLR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21783-PA | 55 | GF21783-PA | 1..55 | 1..65 | 258 | 84.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18316-PA | 65 | GG18316-PA | 1..65 | 1..65 | 328 | 100 | Plus |
Dere\GG11974-PA | 64 | GG11974-PA | 1..64 | 1..65 | 268 | 81.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH12901-PA | 65 | GH12901-PA | 1..65 | 1..65 | 328 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS28b-PB | 65 | CG2998-PB | 1..65 | 1..65 | 329 | 100 | Plus |
RpS28b-PA | 65 | CG2998-PA | 1..65 | 1..65 | 329 | 100 | Plus |
RpS28a-PA | 64 | CG15527-PA | 1..64 | 1..65 | 264 | 81.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI14378-PA | 65 | GI14378-PA | 1..65 | 1..65 | 328 | 100 | Plus |
Dmoj\GI17640-PA | 65 | GI17640-PA | 1..54 | 1..54 | 132 | 50 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15566-PA | 65 | GA15566-PA | 1..65 | 1..65 | 328 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11375-PA | 65 | GM11375-PA | 1..65 | 1..65 | 328 | 100 | Plus |
Dsec\GM12191-PA | 136 | GM12191-PA | 78..136 | 7..65 | 251 | 81.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD16052-PA | 65 | GD16052-PA | 1..65 | 1..65 | 328 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19416-PA | 65 | GJ19416-PA | 1..65 | 1..65 | 328 | 100 | Plus |
Dvir\GJ18205-PA | 65 | GJ18205-PA | 1..57 | 1..57 | 131 | 49.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25380-PA | 65 | GK25380-PA | 1..65 | 1..65 | 328 | 100 | Plus |