Clone LD23703 Report

Search the DGRC for LD23703

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:237
Well:3
Vector:pOT2
Associated Gene/TranscriptSet-RA
Protein status:LD23703.pep: gold
Preliminary Size:1300
Sequenced Size:1165

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4299 2001-01-01 Release 2 assignment
CG4299 2002-05-16 Blastp of sequenced clone
Set 2008-04-29 Release 5.5 accounting
Set 2008-08-15 Release 5.9 accounting
Set 2008-12-18 5.12 accounting

Clone Sequence Records

LD23703.complete Sequence

1165 bp (1165 high quality bases) assembled on 2002-05-16

GenBank Submission: AY118922

> LD23703.complete
CAAACGAAAGGTTAAAAATCCGCTTCGCTTCTCTTCTGCTCAACTGTACC
GCCGCTTTTTGTTCAAATATCTCGGGAATTACGAGCGTACACACAACGGA
AGAGCGTGCAGAATGTCGAGCGTGCCAAAGCGAGCCAAGCTGGACGGCGC
CCCCGCCGATGGCAACACATCCGCCGCCGCCGGTAACAACGAGGAGGAGT
CGGAGGCGTTGGAGCAAATTGATGCCTGCCAGAACGAGATCGATGCGCTG
AACGAGAAGGCCAGCGAGGAGATCCTCAAGGTGGAGCAGAAGTACAACAA
GCTGCGGAAGCCCTGCTACGAGAAGCGCAGCGAGCTGGTCAAGCGCATCC
CCAACTTTTGGGTGACCTCGTTTATCAACCACCCGCAAGTATCCGGCATT
CTGGACGAGGAGGAGGAGGAGTGCCTGCACGCGCTCAACAAACTTGAGGT
TGAGGAGTTTGAGGACATCAAATCGGGTTACCGCATCAACTTCCATTTCG
ACGAGAATCCTTACTTCGAAAACAAGGTGCTCACCAAAGAGTTCCACCTG
AATTCAGCGGCTGCTTCCGAGAACGGAGACTGGCCCGCGTCTACCAGCAC
GCCCATCAAATGGAAGGAGGGAAAGAACCTGCTAAAACTTTTGCTGACAA
AGCCGTACGGAAACAAGAAGAAGCGCAACTCCGAATACAAAACCTTCTTC
GATTGGTTCTCGGATAACACCGATCCCGTCAACGACGAGATCGCAGAACT
GATAAAAGACGACCTTTGGCCAAATCCACTGCAGTATTATCTGGTACCTG
ATATCGAGGTGGAGCCCGAGGACGAGGAGGACAACGAAGATAATGATGAG
GAGGCATTTGACGACGAGGACGGTGAGGATGGAGAAGGCGAGGAAGAGGA
AGAGGATGAGGATGACAAGTAAACTGATTAATGCAATTTCAAATCGCTCG
CAACCGAAGGCCCACATTGTTTATAACCACTGGCAACTATAGTTTTCCCG
ATGGTTATGCAACATTTACATATTCGCAACGATTTAAGGACATATTTAGG
TTTCGAAATAAGCAAAAGTCATACATCCATTAAAGAGCAGCAGAAAATGA
GAATCACCATTAAATTAATTTAAAACAAATAAAAAGACGTAAATCGAAAA
AAAAAAAAAAAAAAA

LD23703.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
Set-RA 1283 Set-RA 81..1228 1..1148 5740 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:24:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11088205..11088574 1..370 1850 100 Plus
chr3R 27901430 chr3R 11089234..11089585 560..911 1760 100 Plus
chr3R 27901430 chr3R 11089648..11089883 911..1146 1180 100 Plus
chr3R 27901430 chr3R 11088982..11089172 370..560 955 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:13:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15263575..15263944 1..370 1850 100 Plus
3R 32079331 3R 15264604..15264955 560..911 1760 100 Plus
3R 32079331 3R 15265018..15265255 911..1148 1190 100 Plus
3R 32079331 3R 15264352..15264542 370..560 955 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:38:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15004406..15004775 1..370 1850 100 Plus
3R 31820162 3R 15005435..15005786 560..911 1760 100 Plus
3R 31820162 3R 15005849..15006086 911..1148 1190 100 Plus
3R 31820162 3R 15005183..15005373 370..560 955 100 Plus
Blast to na_te.dros performed 2019-03-15 22:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 7734..7807 238..309 112 64.9 Plus

LD23703.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:24:55 Download gff for LD23703.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11089648..11089883 911..1146 100   Plus
chr3R 11088205..11088574 1..370 100 -> Plus
chr3R 11088983..11089172 371..560 100 -> Plus
chr3R 11089235..11089479 561..805 100 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:00:48 Download gff for LD23703.complete
Subject Subject Range Query Range Percent Splice Strand
Set-RA 1..810 113..922 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:50:48 Download gff for LD23703.complete
Subject Subject Range Query Range Percent Splice Strand
Set-RA 1..810 113..922 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:18:12 Download gff for LD23703.complete
Subject Subject Range Query Range Percent Splice Strand
Set-RA 1..810 113..922 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:43:27 Download gff for LD23703.complete
Subject Subject Range Query Range Percent Splice Strand
Set-RA 1..810 113..922 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:21:08 Download gff for LD23703.complete
Subject Subject Range Query Range Percent Splice Strand
Set-RA 1..810 113..922 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:28:14 Download gff for LD23703.complete
Subject Subject Range Query Range Percent Splice Strand
Set-RA 41..1186 1..1146 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:50:48 Download gff for LD23703.complete
Subject Subject Range Query Range Percent Splice Strand
Set-RA 41..1186 1..1146 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:18:12 Download gff for LD23703.complete
Subject Subject Range Query Range Percent Splice Strand
Set-RA 24..1169 1..1146 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:43:27 Download gff for LD23703.complete
Subject Subject Range Query Range Percent Splice Strand
Set-RA 41..1186 1..1146 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:21:08 Download gff for LD23703.complete
Subject Subject Range Query Range Percent Splice Strand
Set-RA 24..1169 1..1146 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:24:55 Download gff for LD23703.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15263575..15263944 1..370 100 -> Plus
3R 15264353..15264542 371..560 100 -> Plus
3R 15264605..15264955 561..911 100 -> Plus
3R 15265019..15265253 912..1146 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:24:55 Download gff for LD23703.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15263575..15263944 1..370 100 -> Plus
3R 15264353..15264542 371..560 100 -> Plus
3R 15264605..15264955 561..911 100 -> Plus
3R 15265019..15265253 912..1146 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:24:55 Download gff for LD23703.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15263575..15263944 1..370 100 -> Plus
3R 15264353..15264542 371..560 100 -> Plus
3R 15264605..15264955 561..911 100 -> Plus
3R 15265019..15265253 912..1146 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:18:12 Download gff for LD23703.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11089297..11089666 1..370 100 -> Plus
arm_3R 11090075..11090264 371..560 100 -> Plus
arm_3R 11090327..11090677 561..911 100 -> Plus
arm_3R 11090741..11090975 912..1146 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:15:43 Download gff for LD23703.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15004406..15004775 1..370 100 -> Plus
3R 15005184..15005373 371..560 100 -> Plus
3R 15005436..15005786 561..911 100 -> Plus
3R 15005850..15006084 912..1146 100   Plus

LD23703.hyp Sequence

Translation from 0 to 921

> LD23703.hyp
KRKVKNPLRFSSAQLYRRFLFKYLGNYERTHNGRACRMSSVPKRAKLDGA
PADGNTSAAAGNNEEESEALEQIDACQNEIDALNEKASEEILKVEQKYNK
LRKPCYEKRSELVKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEV
EEFEDIKSGYRINFHFDENPYFENKVLTKEFHLNSAAASENGDWPASTST
PIKWKEGKNLLKLLLTKPYGNKKKRNSEYKTFFDWFSDNTDPVNDEIAEL
IKDDLWPNPLQYYLVPDIEVEPEDEEDNEDNDEEAFDDEDGEDGEGEEEE
EDEDDK*

LD23703.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
Set-PA 269 CG4299-PA 1..269 38..306 1438 100 Plus
Nap1-PC 370 CG5330-PC 64..353 79..296 206 24.3 Plus
Nap1-PB 370 CG5330-PB 64..353 79..296 206 24.3 Plus
Nap1-PA 370 CG5330-PA 64..353 79..296 206 24.3 Plus
mil-PA 283 CG5017-PA 28..283 64..306 168 22.7 Plus

LD23703.pep Sequence

Translation from 112 to 921

> LD23703.pep
MSSVPKRAKLDGAPADGNTSAAAGNNEEESEALEQIDACQNEIDALNEKA
SEEILKVEQKYNKLRKPCYEKRSELVKRIPNFWVTSFINHPQVSGILDEE
EEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVLTKEFHLNSAA
ASENGDWPASTSTPIKWKEGKNLLKLLLTKPYGNKKKRNSEYKTFFDWFS
DNTDPVNDEIAELIKDDLWPNPLQYYLVPDIEVEPEDEEDNEDNDEEAFD
DEDGEDGEGEEEEEDEDDK*

LD23703.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11410-PA 273 GF11410-PA 1..233 1..229 1148 95.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16903-PA 269 GG16903-PA 1..269 1..269 1363 97.8 Plus
Dere\GG19979-PA 369 GG19979-PA 76..319 52..226 153 23.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18852-PA 265 GH18852-PA 1..226 1..229 1087 91.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:02
Subject Length Description Subject Range Query Range Score Percent Strand
Set-PA 269 CG4299-PA 1..269 1..269 1438 100 Plus
Nap1-PC 370 CG5330-PC 64..353 42..259 206 24.3 Plus
Nap1-PB 370 CG5330-PB 64..353 42..259 206 24.3 Plus
Nap1-PA 370 CG5330-PA 64..353 42..259 206 24.3 Plus
mil-PA 283 CG5017-PA 28..283 27..269 168 22.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22922-PA 265 GI22922-PA 1..226 1..229 1125 95.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:22:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12537-PA 266 GL12537-PA 1..226 1..229 1114 93.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:22:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18091-PA 266 GA18091-PA 1..226 1..229 1115 93.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24211-PA 269 GM24211-PA 1..269 1..269 1373 98.5 Plus
Dsec\GM15492-PA 370 GM15492-PA 64..319 42..226 147 23.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19001-PA 269 GD19001-PA 1..269 1..269 1377 98.9 Plus
Dsim\GD24995-PA 370 GD24995-PA 64..319 42..226 147 23.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:22:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23206-PA 265 GJ23206-PA 1..225 1..228 1116 94.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:22:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13791-PA 266 GK13791-PA 1..229 1..233 1140 95.3 Plus
Dwil\GK15855-PA 369 GK15855-PA 34..319 1..226 154 23.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:22:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24285-PA 269 GE24285-PA 1..269 1..269 1380 98.9 Plus
Dyak\Nap1-PA 371 GE11512-PA 76..319 52..226 154 23.6 Plus