Clone LD23740 Report

Search the DGRC for LD23740

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:237
Well:40
Vector:pOT2
Associated Gene/TranscriptSdhB-RA
Protein status:LD23740.pep: gold
Preliminary Size:1300
Sequenced Size:1247

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3283 2001-01-01 Release 2 assignment
CG3283 2002-05-15 Blastp of sequenced clone
CG3283 2003-01-01 Sim4 clustering to Release 3
SdhB 2008-04-29 Release 5.5 accounting
SdhB 2008-08-15 Release 5.9 accounting
SdhB 2008-12-18 5.12 accounting

Clone Sequence Records

LD23740.complete Sequence

1247 bp (1247 high quality bases) assembled on 2002-05-15

GenBank Submission: AY118923

> LD23740.complete
CCACACTGCACCCTCAGTTTCGTGCAACTTTTTGTACGCAAATAAGAAAA
ACATTAAATTTGCTCTCAGCAAATCGATAATTGCAAACGCAGTGCCGTTT
CAATTGCAGCACAAACCGCAACGAAAATGTTGGCGACCGAGGCGAGACAG
ATCCTGAGCCGCGTGGGATCCCTGGTGGCCAGGAACCAGATGCGCGCCAT
CAGCAATGGCACCGCCCAGCTGGAGCAGCAGGCGCAGCCCAAGGAGGCCC
AGGAGCCGCAGATCAAGAAGTTCGAGATCTACCGCTGGAACCCGGACAAC
GCCGGCGAGAAGCCGTACATGCAGACCTACGAGGTGGACCTGCGCGAGTG
CGGCCCCATGGTGCTGGACGCGCTGATCAAGATCAAGAACGAGATGGACC
CCACGCTCACCTTTAGGCGCTCCTGTCGCGAGGGCATCTGCGGCTCCTGC
GCCATGAACATCGGCGGCACCAACACGCTGGCCTGCATCAGCAAGATCGA
CATCAACACCTCCAAGTCGCTGAAGGTGTACCCGCTGCCCCATATGTACG
TGGTGCGCGACCTGGTCCCGGACATGAACAACTTCTACGAGCAGTACCGC
AACATCCAGCCCTGGCTGCAGCGCAAGAACGAAGCGGGCGAGAAGAAGGG
CAAGGCCCAGTACCTGCAGTCCGTCGAGGATCGCTCCAAGTTGGACGGCC
TGTACGAGTGCATCCTGTGCGCCTGCTGCTCCACCTCGTGCCCCTCGTAC
TGGTGGAACGCCGAGAAGTACCTGGGCCCCGCCGTGCTGATGCAGGCCTA
CCGCTGGATCATCGACTCGCGTGACGAGAACTCCGCCGAGCGTCTGAACA
AGTTGAAGGACCCCTTCAGCGTCTACCGGTGCCACACGATCATGAACTGC
ACGCGCACCTGCCCCAAGGGGCTCAATCCCGGCCGTGCCATCGCCGAGAT
CAAGAAGCTGCTCTCGGGCCTGGCCTCCAAGCCGGCTCCGAAGCTGGAGA
CGGCGGCGCTGCACAAGTAGGGCCCAAGTCCTCTACTCCCAGTTCGTCCC
CTGCTGTCCTTAACCAGTGAGCTAAGCCTCCGAAAATGTGTATTGGAGAC
TCCTCCAGCCAACATGCTTACTATGTTATAATTTATTTAAGCCTAAAGTA
TCCGACACTTGTTATTACAGTTTGTAAAGGGAACAAGACGCGAAAATAAA
TAATTGTGTATCCACCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LD23740.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:08:05
Subject Length Description Subject Range Query Range Score Percent Strand
SdhB-RA 1306 SdhB-RA 29..1245 1..1217 6085 100 Plus
SdhB.a 1287 SdhB.a 257..1287 187..1217 5155 100 Plus
SdhB.a 1287 SdhB.a 19..207 1..189 945 100 Plus
CG7349-RA 1903 CG7349-RA 767..942 311..486 595 89.2 Plus
CG7349-RA 1903 CG7349-RA 1145..1281 692..828 340 83.2 Plus
CG7349-RA 1903 CG7349-RA 991..1083 535..627 240 83.8 Plus
CG7349-RA 1903 CG7349-RA 1327..1382 874..929 145 83.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:09:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2695819..2696412 623..1216 2955 99.8 Plus
chr2R 21145070 chr2R 2695327..2695767 187..627 2205 100 Plus
chr2R 21145070 chr2R 2694869..2695057 1..189 945 100 Plus
chrX 22417052 chrX 18784521..18785019 311..812 845 78.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:13:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:09:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6808579..6809173 623..1217 2960 99.8 Plus
2R 25286936 2R 6808087..6808527 187..627 2205 100 Plus
2R 25286936 2R 6807629..6807817 1..189 945 100 Plus
X 23542271 X 18895391..18895889 311..812 845 78.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6809778..6810372 623..1217 2960 99.8 Plus
2R 25260384 2R 6809286..6809726 187..627 2205 100 Plus
2R 25260384 2R 6808828..6809016 1..189 945 100 Plus
X 23527363 X 18903489..18903664 311..486 595 89.2 Plus
X 23527363 X 18903867..18903987 692..812 335 85.1 Plus
X 23527363 X 18903713..18903805 535..627 240 83.8 Plus
X 23527363 X 18904105..18904160 874..929 145 83.9 Plus
Blast to na_te.dros performed 2019-03-16 02:09:32
Subject Length Description Subject Range Query Range Score Percent Strand
INE-1 611 INE-1 INE1 611bp Derived from U66884 (e1371475) (Rel. 52, Last updated, Version 6). 450..491 79..40 115 78.6 Minus

LD23740.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:10:40 Download gff for LD23740.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2694869..2695057 1..189 100 -> Plus
chr2R 2695330..2695766 190..626 100 -> Plus
chr2R 2695823..2696412 627..1216 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:00:52 Download gff for LD23740.complete
Subject Subject Range Query Range Percent Splice Strand
SdhB-RA 1..894 127..1020 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:51:25 Download gff for LD23740.complete
Subject Subject Range Query Range Percent Splice Strand
SdhB-RA 1..894 127..1020 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:34:54 Download gff for LD23740.complete
Subject Subject Range Query Range Percent Splice Strand
SdhB-RA 1..894 127..1020 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:44:01 Download gff for LD23740.complete
Subject Subject Range Query Range Percent Splice Strand
SdhB-RA 1..894 127..1020 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:58:41 Download gff for LD23740.complete
Subject Subject Range Query Range Percent Splice Strand
SdhB-RA 1..894 127..1020 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:29:14 Download gff for LD23740.complete
Subject Subject Range Query Range Percent Splice Strand
SdhB-RA 19..1234 1..1216 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:51:25 Download gff for LD23740.complete
Subject Subject Range Query Range Percent Splice Strand
SdhB-RA 18..1233 1..1216 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:34:54 Download gff for LD23740.complete
Subject Subject Range Query Range Percent Splice Strand
SdhB-RA 4..1219 1..1216 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:44:02 Download gff for LD23740.complete
Subject Subject Range Query Range Percent Splice Strand
SdhB-RA 19..1234 1..1216 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:58:41 Download gff for LD23740.complete
Subject Subject Range Query Range Percent Splice Strand
SdhB-RA 4..1219 1..1216 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:10:40 Download gff for LD23740.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6807629..6807817 1..189 100 -> Plus
2R 6808090..6808526 190..626 100 -> Plus
2R 6808583..6809172 627..1216 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:10:40 Download gff for LD23740.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6807629..6807817 1..189 100 -> Plus
2R 6808090..6808526 190..626 100 -> Plus
2R 6808583..6809172 627..1216 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:10:40 Download gff for LD23740.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6807629..6807817 1..189 100 -> Plus
2R 6808090..6808526 190..626 100 -> Plus
2R 6808583..6809172 627..1216 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:34:54 Download gff for LD23740.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2695134..2695322 1..189 100 -> Plus
arm_2R 2695595..2696031 190..626 100 -> Plus
arm_2R 2696088..2696677 627..1216 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:16:21 Download gff for LD23740.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6809289..6809725 190..626 100 -> Plus
2R 6809782..6810371 627..1216 100   Plus
2R 6808828..6809016 1..189 100 -> Plus

LD23740.pep Sequence

Translation from 126 to 1019

> LD23740.pep
MLATEARQILSRVGSLVARNQMRAISNGTAQLEQQAQPKEAQEPQIKKFE
IYRWNPDNAGEKPYMQTYEVDLRECGPMVLDALIKIKNEMDPTLTFRRSC
REGICGSCAMNIGGTNTLACISKIDINTSKSLKVYPLPHMYVVRDLVPDM
NNFYEQYRNIQPWLQRKNEAGEKKGKAQYLQSVEDRSKLDGLYECILCAC
CSTSCPSYWWNAEKYLGPAVLMQAYRWIIDSRDENSAERLNKLKDPFSVY
RCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLASKPAPKLETAALHK*

LD23740.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11072-PA 297 GF11072-PA 1..297 1..297 1536 95.3 Plus
Dana\GF19050-PA 444 GF19050-PA 193..441 45..297 984 69.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:40:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23224-PA 297 GG23224-PA 1..297 1..297 1573 98 Plus
Dere\GG19200-PA 412 GG19200-PA 156..407 40..295 1024 72.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:40:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21756-PA 296 GH21756-PA 1..296 1..297 1485 91.9 Plus
Dgri\GH10931-PA 335 GH10931-PA 60..330 21..295 997 63.3 Plus
Dgri\GH24727-PA 331 GH24727-PA 78..326 43..295 971 68.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
SdhB-PA 297 CG3283-PA 1..297 1..297 1586 100 Plus
SdhBL-PC 437 CG7349-PC 175..432 34..295 1032 71.8 Plus
SdhBL-PA 437 CG7349-PA 175..432 34..295 1032 71.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:40:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19303-PA 296 GI19303-PA 1..296 1..297 1499 92.9 Plus
Dmoj\GI14882-PA 362 GI14882-PA 112..332 42..266 916 72.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:40:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11120-PA 297 GL11120-PA 1..297 1..297 1516 92.9 Plus
Dper\GL21331-PA 375 GL21331-PA 118..372 38..296 1020 71 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:40:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17170-PA 297 GA17170-PA 1..297 1..297 1516 92.9 Plus
Dpse\GA20284-PA 371 GA20284-PA 121..368 45..296 1002 71.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:40:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20899-PA 297 GM20899-PA 1..297 1..297 1592 99.7 Plus
Dsec\GM22932-PA 440 GM22932-PA 184..435 40..295 1033 72.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:40:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10425-PA 297 GD10425-PA 1..297 1..297 1599 100 Plus
Dsim\GD17417-PA 462 GD17417-PA 206..457 40..295 1031 72.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:40:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22180-PA 296 GJ22180-PA 1..296 1..297 1467 90.6 Plus
Dvir\GJ15311-PA 382 GJ15311-PA 117..379 36..297 997 67.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:40:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22142-PA 297 GK22142-PA 1..297 1..297 1514 92.9 Plus
Dwil\GK25101-PA 366 GK25101-PA 112..364 40..296 992 70.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:40:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19076-PA 297 GE19076-PA 1..297 1..297 1592 99.3 Plus
Dyak\GE17763-PA 425 GE17763-PA 169..420 40..295 1009 70.7 Plus

LD23740.hyp Sequence

Translation from 126 to 1019

> LD23740.hyp
MLATEARQILSRVGSLVARNQMRAISNGTAQLEQQAQPKEAQEPQIKKFE
IYRWNPDNAGEKPYMQTYEVDLRECGPMVLDALIKIKNEMDPTLTFRRSC
REGICGSCAMNIGGTNTLACISKIDINTSKSLKVYPLPHMYVVRDLVPDM
NNFYEQYRNIQPWLQRKNEAGEKKGKAQYLQSVEDRSKLDGLYECILCAC
CSTSCPSYWWNAEKYLGPAVLMQAYRWIIDSRDENSAERLNKLKDPFSVY
RCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLASKPAPKLETAALHK*

LD23740.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:48:09
Subject Length Description Subject Range Query Range Score Percent Strand
SdhB-PA 297 CG3283-PA 1..297 1..297 1586 100 Plus
CG7349-PC 437 CG7349-PC 175..432 34..295 1032 71.8 Plus
CG7349-PA 437 CG7349-PA 175..432 34..295 1032 71.8 Plus