Clone LD23767 Report

Search the DGRC for LD23767

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:237
Well:67
Vector:pOT2
Associated Gene/TranscriptTango7-RA
Protein status:LD23767.pep: gold
Preliminary Size:1300
Sequenced Size:1396

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8309 2001-01-01 Release 2 assignment
CG8309 2002-05-16 Blastp of sequenced clone
CG8309 2003-01-01 Sim4 clustering to Release 3
Tango7 2008-04-29 Release 5.5 accounting
Tango7 2008-08-15 Release 5.9 accounting
Tango7 2008-12-18 5.12 accounting

Clone Sequence Records

LD23767.complete Sequence

1396 bp (1396 high quality bases) assembled on 2002-05-16

GenBank Submission: AY118924

> LD23767.complete
TCAAAGCGCCGAAGACGTGTGTGCGTGTTATTTTCAGCTGAATTTGTTTA
AAAAAGTGGAATAACATTTAACAAAACCATGACTTCGCATCCGGTTTTCA
TAGACCTGTCCCTGGACGAGCAGGTGCAAGAGCTGCGCAAGTATTTCAAG
AAGCTGGGAGCCGAAATCTCATCGGAGAAGTCCAATAAAGGTGTGGAGGA
TGATTTGCACAAGATCATCGGCGTCTGCGACGTTTGCTTTAAGGATGGTG
AGCCCTCGCAGATTGATGGAATTCTAAACAGCATTGTGTCCATCATGATC
ACGATACCCCTGGATCGCGGTGAGAACATTGTCCTGGCCTACTGCGAGAA
GATGACCAAGGCTCCCAATCTTCCATTGGGCAAGGTGTGCCTTCAGTCGT
TGTGGCGTCTGTTCAACAACCTGGACACCGCCTCTCCCTTACGCTACCAT
GTGTACTACCACCTGGTCCAGGTGGCCAAGCAGTGCGAACAGGTGCTGGA
GGTCTTCTCAGGTGTGGATCAGCTCAAATCCCAGTTTGCCAACTGCCCAC
CTTCGTCGGAACAGATGCAGAAGCTGTACCGCCTGCTGCACGACGTGACC
AAGGACACCAACCTGGAGCTGTCTTCCAAGGTTATGATTGAGCTGCTGGG
CACCTACACGGCGGACAATGCTTGTGTTGCCCGTGAGGATGCCATGAAGT
GCATTGTGACTGCCTTGGCCGACCCCAATACATTCCTGCTGGATCCTCTG
CTGTCGCTGAAGCCTGTGCGCTTTTTGGAAGGCGACCTCATCCACGACCT
GCTGTCCATCTTCGTGTCCGAGAAGCTGCCAGCGTACGTGCAGTTCTACG
AGGATCACAGGGAGTTTGTCAACTCGCAAGGATTGAACCATGAGCAGAAC
ATGAAGAAGATGCGTCTGCTGACCTTCATGCAGCTGGCCGAGAGCAGCCC
GGAGATGACATTCGAAACGCTTACCAAGGAGCTGCAGATCAACGAAGACG
AGGTGGAGCCCTTCGTCATCGAGGTGCTGAAAACAAAGCTGGTACGCGCA
CGACTAGATCAGGCCAATCAAAAGGTACACATCTCATCGACAATGCACCG
AACCTTTGGAGCACCACAATGGGAGCAGCTTCGCGATTTGCTGCAGGCAT
GGAAGGAGAACCTCAGCACAGTGCGCGAGGGTCTAACGAGCGTCTCCTCG
GCGCAACTGGATCTGGCTCGATCCCAGAAGCTGATACACTAGGCGCACCA
CTTCCAAAAAATTGCACTGATGATGAACAAATGCTGGCCTCGGGGCACTG
GAGTGACGACCTAAATTATTTTCAAGAATGCGAGAGGGCTGGATAACTTG
AATAAATTTATAAGTAAAATCGGTAAAAAAAAAAAAAAAAAAAAAA

LD23767.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
Tango7-RA 1860 Tango7-RA 274..1648 1..1375 6875 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:37:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10050390..10051459 1371..303 5240 99.5 Minus
chr2R 21145070 chr2R 10051513..10051694 303..122 880 98.9 Minus
chr2R 21145070 chr2R 10051807..10051931 125..1 625 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:13:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14163065..14164137 1375..303 5365 100 Minus
2R 25286936 2R 14164191..14164372 303..122 910 100 Minus
2R 25286936 2R 14164485..14164609 125..1 625 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14164264..14165336 1375..303 5365 100 Minus
2R 25260384 2R 14165390..14165571 303..122 910 100 Minus
2R 25260384 2R 14165684..14165808 125..1 625 100 Minus
Blast to na_te.dros performed on 2019-03-16 10:37:09 has no hits.

LD23767.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:37:56 Download gff for LD23767.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10050387..10051458 304..1374 99 <- Minus
chr2R 10051513..10051692 124..303 98 <- Minus
chr2R 10051809..10051931 1..123 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:00:56 Download gff for LD23767.complete
Subject Subject Range Query Range Percent Splice Strand
Tango7-RA 1..1164 79..1242 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:50:50 Download gff for LD23767.complete
Subject Subject Range Query Range Percent Splice Strand
Tango7-RA 1..1164 79..1242 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:59:22 Download gff for LD23767.complete
Subject Subject Range Query Range Percent Splice Strand
Tango7-RA 1..1164 79..1242 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:43:28 Download gff for LD23767.complete
Subject Subject Range Query Range Percent Splice Strand
Tango7-RA 1..1164 79..1242 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:13:15 Download gff for LD23767.complete
Subject Subject Range Query Range Percent Splice Strand
Tango7-RA 1..1164 79..1242 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:28:17 Download gff for LD23767.complete
Subject Subject Range Query Range Percent Splice Strand
Tango7-RA 261..1634 1..1374 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:50:49 Download gff for LD23767.complete
Subject Subject Range Query Range Percent Splice Strand
Tango7-RA 261..1634 1..1374 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:59:22 Download gff for LD23767.complete
Subject Subject Range Query Range Percent Splice Strand
Tango7-RA 217..1590 1..1374 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:43:28 Download gff for LD23767.complete
Subject Subject Range Query Range Percent Splice Strand
Tango7-RA 261..1634 1..1374 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:13:15 Download gff for LD23767.complete
Subject Subject Range Query Range Percent Splice Strand
Tango7-RA 217..1590 1..1374 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:37:56 Download gff for LD23767.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14163066..14164136 304..1374 100 <- Minus
2R 14164191..14164370 124..303 100 <- Minus
2R 14164487..14164609 1..123 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:37:56 Download gff for LD23767.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14163066..14164136 304..1374 100 <- Minus
2R 14164191..14164370 124..303 100 <- Minus
2R 14164487..14164609 1..123 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:37:56 Download gff for LD23767.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14163066..14164136 304..1374 100 <- Minus
2R 14164191..14164370 124..303 100 <- Minus
2R 14164487..14164609 1..123 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:59:22 Download gff for LD23767.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10050571..10051641 304..1374 100 <- Minus
arm_2R 10051696..10051875 124..303 100 <- Minus
arm_2R 10051992..10052114 1..123 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:15:44 Download gff for LD23767.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14164265..14165335 304..1374 100 <- Minus
2R 14165390..14165569 124..303 100 <- Minus
2R 14165686..14165808 1..123 100   Minus

LD23767.hyp Sequence

Translation from 78 to 1241

> LD23767.hyp
MTSHPVFIDLSLDEQVQELRKYFKKLGAEISSEKSNKGVEDDLHKIIGVC
DVCFKDGEPSQIDGILNSIVSIMITIPLDRGENIVLAYCEKMTKAPNLPL
GKVCLQSLWRLFNNLDTASPLRYHVYYHLVQVAKQCEQVLEVFSGVDQLK
SQFANCPPSSEQMQKLYRLLHDVTKDTNLELSSKVMIELLGTYTADNACV
AREDAMKCIVTALADPNTFLLDPLLSLKPVRFLEGDLIHDLLSIFVSEKL
PAYVQFYEDHREFVNSQGLNHEQNMKKMRLLTFMQLAESSPEMTFETLTK
ELQINEDEVEPFVIEVLKTKLVRARLDQANQKVHISSTMHRTFGAPQWEQ
LRDLLQAWKENLSTVREGLTSVSSAQLDLARSQKLIH*

LD23767.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:22:32
Subject Length Description Subject Range Query Range Score Percent Strand
Tango7-PB 387 CG8309-PB 1..387 1..387 1983 100 Plus
Tango7-PA 387 CG8309-PA 1..387 1..387 1983 100 Plus

LD23767.pep Sequence

Translation from 78 to 1241

> LD23767.pep
MTSHPVFIDLSLDEQVQELRKYFKKLGAEISSEKSNKGVEDDLHKIIGVC
DVCFKDGEPSQIDGILNSIVSIMITIPLDRGENIVLAYCEKMTKAPNLPL
GKVCLQSLWRLFNNLDTASPLRYHVYYHLVQVAKQCEQVLEVFSGVDQLK
SQFANCPPSSEQMQKLYRLLHDVTKDTNLELSSKVMIELLGTYTADNACV
AREDAMKCIVTALADPNTFLLDPLLSLKPVRFLEGDLIHDLLSIFVSEKL
PAYVQFYEDHREFVNSQGLNHEQNMKKMRLLTFMQLAESSPEMTFETLTK
ELQINEDEVEPFVIEVLKTKLVRARLDQANQKVHISSTMHRTFGAPQWEQ
LRDLLQAWKENLSTVREGLTSVSSAQLDLARSQKLIH*

LD23767.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12901-PA 387 GF12901-PA 1..387 1..387 2010 96.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22442-PA 387 GG22442-PA 1..387 1..387 2055 99 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22989-PA 387 GH22989-PA 1..387 1..387 1989 94.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
eIF3m-PB 387 CG8309-PB 1..387 1..387 1983 100 Plus
eIF3m-PA 387 CG8309-PA 1..387 1..387 1983 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:23:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18957-PA 387 GI18957-PA 1..387 1..387 2010 96.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:23:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10828-PA 387 GL10828-PA 1..387 1..387 2006 95.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:23:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20974-PA 387 GA20974-PA 1..387 1..387 2002 95.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20228-PA 387 GM20228-PA 1..387 1..387 2069 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25700-PA 387 GD25700-PA 1..387 1..387 2069 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:23:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21564-PA 387 GJ21564-PA 1..387 1..387 1997 95.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22125-PA 387 GK22125-PA 1..387 1..387 1987 95.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12333-PA 387 GE12333-PA 1..387 1..387 2053 98.7 Plus