Clone LD23808 Report

Search the DGRC for LD23808

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:238
Well:8
Vector:pOT2
Associated Gene/TranscriptRpS12-RB
Protein status:LD23808.pep: gold
Preliminary Size:600
Sequenced Size:595

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11271 2001-01-01 Release 2 assignment
CG11271 2001-09-19 Blastp of sequenced clone
RpS12 2008-04-29 Release 5.5 accounting
RpS12 2008-08-15 Release 5.9 accounting
RpS12 2008-12-18 5.12 accounting

Clone Sequence Records

LD23808.complete Sequence

595 bp (595 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058531

> LD23808.complete
CAAAAGTGCAGTGCATCCTTAACCGCAGAACAATGGCCGACGTTGATGTT
GATGTTCCCTCCGCTGCCCCTGTGCTCGATGGCGCCATGGACATTAACAC
TGCCCTCCAGGAGGTCTTGAAGAAGTCCCTGATCGCCGATGGACTCGTCC
ATGGCATCCACCAGGCCTGCAAGGCCCTGGACAAGCGTCAGGCTGTTCTG
TGCATCCTAGCCGAGTCCTTCGACGAGCCCAACTACAAGAAGCTGGTTAC
CGCCCTGTGCAACGAGCACCAGATCCCCCTTATCCGCGTGGACTCGCACA
AGAAGCTGGGCGAATGGTCCGGTCTGTGCAAGATCGACAAGGAGGGCAAG
CCCCGCAAGGTGTGCGGCTGCTCCGTGGTCGTGATCAAGGATTTCGGTGA
GGAGACACCCGCTTTGGACGTGGTTAAGGACCATCTCAGGCAGAACAGCT
AAACAGCTGCGCACTGCCTGCTGAATGAGAGACTACGTGAAAGTTCTTTT
TAAGCTATTCGCTAATTGAAAATAAAACGTATTGAACCTGAATCCAGATG
AAAAAATAAAAGAAAGTCGACCTTTTTAAAAAAAAAAAAAAAAAA

LD23808.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:20:17
Subject Length Description Subject Range Query Range Score Percent Strand
RpS12-RB 616 RpS12-RB 40..616 1..577 2885 100 Plus
RpS12.a 614 RpS12.a 23..591 10..578 2845 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:04:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13014667..13015063 181..577 1940 99.2 Plus
chr3L 24539361 chr3L 13014030..13014165 50..185 680 100 Plus
chr3L 24539361 chr3L 13013779..13013823 5..49 225 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:14:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:04:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13024366..13024763 181..578 1975 99.7 Plus
3L 28110227 3L 13023732..13023867 50..185 680 100 Plus
3L 28110227 3L 13023481..13023525 5..49 225 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:43:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13017466..13017863 181..578 1975 99.7 Plus
3L 28103327 3L 13016832..13016967 50..185 680 100 Plus
3L 28103327 3L 13016581..13016625 5..49 225 100 Plus
Blast to na_te.dros performed on 2019-03-16 04:04:36 has no hits.

LD23808.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:05:15 Download gff for LD23808.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13013778..13013823 1..49 93 -> Plus
chr3L 13014030..13014164 50..184 100 -> Plus
chr3L 13014671..13015063 185..577 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:01:01 Download gff for LD23808.complete
Subject Subject Range Query Range Percent Splice Strand
RpS12-RC 1..420 33..452 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:03:40 Download gff for LD23808.complete
Subject Subject Range Query Range Percent Splice Strand
RpS12-RB 1..420 33..452 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:15:37 Download gff for LD23808.complete
Subject Subject Range Query Range Percent Splice Strand
RpS12-RB 1..420 33..452 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:34:16 Download gff for LD23808.complete
Subject Subject Range Query Range Percent Splice Strand
RpS12-RC 1..420 33..452 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:25:44 Download gff for LD23808.complete
Subject Subject Range Query Range Percent Splice Strand
RpS12-RB 1..420 33..452 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:52:24 Download gff for LD23808.complete
Subject Subject Range Query Range Percent Splice Strand
RpS12-RB 20..596 1..577 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:03:40 Download gff for LD23808.complete
Subject Subject Range Query Range Percent Splice Strand
RpS12-RB 33..609 1..577 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:15:37 Download gff for LD23808.complete
Subject Subject Range Query Range Percent Splice Strand
RpS12-RB 37..613 1..577 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:34:16 Download gff for LD23808.complete
Subject Subject Range Query Range Percent Splice Strand
RpS12-RB 20..596 1..577 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:25:44 Download gff for LD23808.complete
Subject Subject Range Query Range Percent Splice Strand
RpS12-RB 37..613 1..577 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:05:15 Download gff for LD23808.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13023732..13023866 50..184 100 -> Plus
3L 13023479..13023525 1..49 93 -> Plus
3L 13024370..13024762 185..577 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:05:15 Download gff for LD23808.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13023732..13023866 50..184 100 -> Plus
3L 13023479..13023525 1..49 93 -> Plus
3L 13024370..13024762 185..577 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:05:15 Download gff for LD23808.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13023732..13023866 50..184 100 -> Plus
3L 13023479..13023525 1..49 93 -> Plus
3L 13024370..13024762 185..577 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:15:37 Download gff for LD23808.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13016579..13016625 1..49 93 -> Plus
arm_3L 13016832..13016966 50..184 100 -> Plus
arm_3L 13017470..13017862 185..577 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:11:09 Download gff for LD23808.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13016579..13016625 1..49 93 -> Plus
3L 13016832..13016966 50..184 100 -> Plus
3L 13017470..13017862 185..577 100   Plus

LD23808.hyp Sequence

Translation from 0 to 451

> LD23808.hyp
PVQCILNRRTMADVDVDVPSAAPVLDGAMDINTALQEVLKKSLIADGLVH
GIHQACKALDKRQAVLCILAESFDEPNYKKLVTALCNEHQIPLIRVDSHK
KLGEWSGLCKIDKEGKPRKVCGCSVVVIKDFGEETPALDVVKDHLRQNS*

LD23808.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:31:01
Subject Length Description Subject Range Query Range Score Percent Strand
RpS12-PB 139 CG11271-PB 1..139 11..149 724 100 Plus

LD23808.pep Sequence

Translation from 32 to 451

> LD23808.pep
MADVDVDVPSAAPVLDGAMDINTALQEVLKKSLIADGLVHGIHQACKALD
KRQAVLCILAESFDEPNYKKLVTALCNEHQIPLIRVDSHKKLGEWSGLCK
IDKEGKPRKVCGCSVVVIKDFGEETPALDVVKDHLRQNS*

LD23808.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:53:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24633-PA 139 GF24633-PA 1..139 1..139 721 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:53:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15618-PA 139 GG15618-PA 1..139 1..139 716 99.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:53:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23307-PA 139 GH23307-PA 1..139 1..139 713 98.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:22
Subject Length Description Subject Range Query Range Score Percent Strand
RpS12-PB 139 CG11271-PB 1..139 1..139 724 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:53:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11681-PA 139 GI11681-PA 1..139 1..139 710 97.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:53:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25268-PA 139 GL25268-PA 1..139 1..139 721 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:53:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10880-PA 139 GA10880-PA 1..139 1..139 721 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:53:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25391-PA 139 GM25391-PA 1..139 1..139 721 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:53:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14423-PA 101 GD14423-PA 13..101 51..139 470 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:53:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11353-PA 139 GJ11353-PA 1..139 1..139 710 97.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:53:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16837-PA 139 GK16837-PA 1..139 1..139 713 98.6 Plus
Dwil\GK16839-PA 139 GK16839-PA 1..139 1..139 713 98.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:53:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpS12-PA 139 GE21945-PA 1..139 1..139 721 100 Plus