BDGP Sequence Production Resources |
Search the DGRC for LD23808
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 238 |
Well: | 8 |
Vector: | pOT2 |
Associated Gene/Transcript | RpS12-RB |
Protein status: | LD23808.pep: gold |
Preliminary Size: | 600 |
Sequenced Size: | 595 |
Gene | Date | Evidence |
---|---|---|
CG11271 | 2001-01-01 | Release 2 assignment |
CG11271 | 2001-09-19 | Blastp of sequenced clone |
RpS12 | 2008-04-29 | Release 5.5 accounting |
RpS12 | 2008-08-15 | Release 5.9 accounting |
RpS12 | 2008-12-18 | 5.12 accounting |
595 bp (595 high quality bases) assembled on 2001-09-19
GenBank Submission: AY058531
> LD23808.complete CAAAAGTGCAGTGCATCCTTAACCGCAGAACAATGGCCGACGTTGATGTT GATGTTCCCTCCGCTGCCCCTGTGCTCGATGGCGCCATGGACATTAACAC TGCCCTCCAGGAGGTCTTGAAGAAGTCCCTGATCGCCGATGGACTCGTCC ATGGCATCCACCAGGCCTGCAAGGCCCTGGACAAGCGTCAGGCTGTTCTG TGCATCCTAGCCGAGTCCTTCGACGAGCCCAACTACAAGAAGCTGGTTAC CGCCCTGTGCAACGAGCACCAGATCCCCCTTATCCGCGTGGACTCGCACA AGAAGCTGGGCGAATGGTCCGGTCTGTGCAAGATCGACAAGGAGGGCAAG CCCCGCAAGGTGTGCGGCTGCTCCGTGGTCGTGATCAAGGATTTCGGTGA GGAGACACCCGCTTTGGACGTGGTTAAGGACCATCTCAGGCAGAACAGCT AAACAGCTGCGCACTGCCTGCTGAATGAGAGACTACGTGAAAGTTCTTTT TAAGCTATTCGCTAATTGAAAATAAAACGTATTGAACCTGAATCCAGATG AAAAAATAAAAGAAAGTCGACCTTTTTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 13014667..13015063 | 181..577 | 1940 | 99.2 | Plus |
chr3L | 24539361 | chr3L | 13014030..13014165 | 50..185 | 680 | 100 | Plus |
chr3L | 24539361 | chr3L | 13013779..13013823 | 5..49 | 225 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 13017466..13017863 | 181..578 | 1975 | 99.7 | Plus |
3L | 28103327 | 3L | 13016832..13016967 | 50..185 | 680 | 100 | Plus |
3L | 28103327 | 3L | 13016581..13016625 | 5..49 | 225 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 13013778..13013823 | 1..49 | 93 | -> | Plus |
chr3L | 13014030..13014164 | 50..184 | 100 | -> | Plus |
chr3L | 13014671..13015063 | 185..577 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS12-RC | 1..420 | 33..452 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS12-RB | 1..420 | 33..452 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS12-RB | 1..420 | 33..452 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS12-RC | 1..420 | 33..452 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS12-RB | 1..420 | 33..452 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS12-RB | 20..596 | 1..577 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS12-RB | 33..609 | 1..577 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS12-RB | 37..613 | 1..577 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS12-RB | 20..596 | 1..577 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS12-RB | 37..613 | 1..577 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13023732..13023866 | 50..184 | 100 | -> | Plus |
3L | 13023479..13023525 | 1..49 | 93 | -> | Plus |
3L | 13024370..13024762 | 185..577 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13023732..13023866 | 50..184 | 100 | -> | Plus |
3L | 13023479..13023525 | 1..49 | 93 | -> | Plus |
3L | 13024370..13024762 | 185..577 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13023732..13023866 | 50..184 | 100 | -> | Plus |
3L | 13023479..13023525 | 1..49 | 93 | -> | Plus |
3L | 13024370..13024762 | 185..577 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 13016579..13016625 | 1..49 | 93 | -> | Plus |
arm_3L | 13016832..13016966 | 50..184 | 100 | -> | Plus |
arm_3L | 13017470..13017862 | 185..577 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13016579..13016625 | 1..49 | 93 | -> | Plus |
3L | 13016832..13016966 | 50..184 | 100 | -> | Plus |
3L | 13017470..13017862 | 185..577 | 100 | Plus |
Translation from 0 to 451
> LD23808.hyp PVQCILNRRTMADVDVDVPSAAPVLDGAMDINTALQEVLKKSLIADGLVH GIHQACKALDKRQAVLCILAESFDEPNYKKLVTALCNEHQIPLIRVDSHK KLGEWSGLCKIDKEGKPRKVCGCSVVVIKDFGEETPALDVVKDHLRQNS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS12-PB | 139 | CG11271-PB | 1..139 | 11..149 | 724 | 100 | Plus |
Translation from 32 to 451
> LD23808.pep MADVDVDVPSAAPVLDGAMDINTALQEVLKKSLIADGLVHGIHQACKALD KRQAVLCILAESFDEPNYKKLVTALCNEHQIPLIRVDSHKKLGEWSGLCK IDKEGKPRKVCGCSVVVIKDFGEETPALDVVKDHLRQNS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24633-PA | 139 | GF24633-PA | 1..139 | 1..139 | 721 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15618-PA | 139 | GG15618-PA | 1..139 | 1..139 | 716 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH23307-PA | 139 | GH23307-PA | 1..139 | 1..139 | 713 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS12-PB | 139 | CG11271-PB | 1..139 | 1..139 | 724 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11681-PA | 139 | GI11681-PA | 1..139 | 1..139 | 710 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25268-PA | 139 | GL25268-PA | 1..139 | 1..139 | 721 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10880-PA | 139 | GA10880-PA | 1..139 | 1..139 | 721 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25391-PA | 139 | GM25391-PA | 1..139 | 1..139 | 721 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14423-PA | 101 | GD14423-PA | 13..101 | 51..139 | 470 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11353-PA | 139 | GJ11353-PA | 1..139 | 1..139 | 710 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16837-PA | 139 | GK16837-PA | 1..139 | 1..139 | 713 | 98.6 | Plus |
Dwil\GK16839-PA | 139 | GK16839-PA | 1..139 | 1..139 | 713 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\RpS12-PA | 139 | GE21945-PA | 1..139 | 1..139 | 721 | 100 | Plus |