Clone LD23816 Report

Search the DGRC for LD23816

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:238
Well:16
Vector:pOT2
Associated Gene/Transcriptsau-RA
Protein status:LD23816.pep: gold
Preliminary Size:2200
Sequenced Size:1722

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7085 2001-09-19 Blastp of sequenced clone
l(2)s5379 2008-04-29 Release 5.5 accounting
l(2)s5379 2008-08-15 Release 5.9 accounting
l(2)s5379 2008-12-18 5.12 accounting

Clone Sequence Records

LD23816.complete Sequence

1722 bp (1722 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058532

> LD23816.complete
CGGAAATCATGTCACGTCGGAACGTCGACAAAAGACACAAATAATAGGAA
AAAGCTTATTTCGCGCAGGCACTCGCATATTCCCAGTAAATGCAAGGCCA
ATGCAAATGCACCATTAGTACGGGCCACCAAATTGTAAATCAAACCGTCG
AGTTCCCAGCGCAAAAACGCCGAGCAAAGCAGCAACAACGAAACGCAGTT
TAGGGCCTGCATTTTTGCGATAGTGTGAAAAGTGCGTGTGTGCAAAAGAA
TACAAAATAAAGGGGGCGCAAAAGAGTCAGTGAAAACAACAACACACAAA
AACACAAGACACAAGTACACAGAGAAAAACGCAAACACCCGCACTCGCGC
AAACAGACACACACACACACTGTGAAACTCCCAACGTCGAGTCAGCAAAT
TGTGCCACACACACAAAACGAGGAAAGAGGAAGAAGAGCAGCAGCAGAAA
AACATAGGTGCTCCGCTCGCATCCCACATCTCCAAAACTCCATCGATCCG
AACTTCCCGACTACCCAACCCAACTCTCCGGAATGAATCGCTCCGACGGA
TTGGTGCGTCGCTCGGTGAAACCCCGCGAAAACGGTGGGGCGGAGGGTGG
GTTGAATGCCAACACGCCGGACGACAACCAGGATGCACTGGACAACCTAA
AGGACCAGGAGGACAATATCGACGATGGCGACTCCAAGGAAACACGACTA
ACGCTCATGGAGGAGGTTCTGCTGCTGGGACTCAAGGACAAGGAGGGCTA
CACATCTTTCTGGAACGACTGCATATCAAGCGGCTTGCGCGGATGCATTC
TCATAGAGCTTGGACTGCGAGGTCGCGTGATGATCGAGAAATCTGGAATG
CGGCGACGTGGTCTATGTACAAGGAAATTAATACTGAAATCGGATCAGCA
GACGGGAGACGTTCTACTCGATGAGGCACTTAAACACATTAAGGAAACAG
ATCCCCCGGAGACGGTGCAGAGCTGGATTGAATATCTTAGTGGTGAAACC
TGGAATCCGTTGAAATTGCGCTACCAACTGAAAAATGTACGCGAACGTCT
GGCCAAAAATCTGGTGGAGAAGGGTGTGCTCACGACGGAAAAGCAAAATT
TTCTACTCTTCGATATGACGACACATCCGCTGAGCGACAATGTTGTCAAA
TGTCGCCTGGTGAAGAAGATCCAAGATTCTGTGCTCTCCAAGTGGGTCAA
CGATCCACAGCGCATGGACAAGCGGATGCTGGCGCTTATCTTCCTGGCGC
ACGCCAGCGATGTGATCGAGAACGCCTTCGCGCCGCTGAATGATGACGAC
TATGAGGTGGCCATGAAGCGGGTGCGGGAGCTGCTGGATCTCGACTTCGA
AGCCGAGTCGGCCAAGCCGAATGCGAACGAAATTCTGTGGGCGGTGTTCA
TGGCGTTCACGAAATAGACGATCCTCTGATCCTCTACGCTCCTCTCAATA
GCACACACACACACACAACACACACCCCAACACAGAAATACAGACCCACA
TCTGGAATACATTTTGCTGCTTTTGTTTTAGAAACTTTGCTGTGAGTGGA
ACCGAATCGGGCGATAGGATTTTCTTAAATGGCAACCACCCCAAATATCT
GTTTCAGTAATATATATTTTTTAAGCGAGACTATAAAGCAGCCATAATTC
CTATTTAAATATACATATGTTTATCAACACTTCAATAATACCAATCAAAC
GCTCAAAAAAAAAAAAAAAAAA

LD23816.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:20:17
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)s5379-RE 1719 l(2)s5379-RE 16..1719 1..1704 8520 100 Plus
l(2)s5379-RD 2463 l(2)s5379-RD 16..1719 1..1704 8520 100 Plus
l(2)s5379-RA 2463 l(2)s5379-RA 16..1719 1..1704 8520 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:23:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2226265..2227010 1..746 3715 99.9 Plus
chr2L 23010047 chr2L 2229622..2230159 1167..1704 2690 100 Plus
chr2L 23010047 chr2L 2229383..2229559 992..1168 885 100 Plus
chr2L 23010047 chr2L 2229010..2229140 744..874 655 100 Plus
chr2L 23010047 chr2L 2229201..2229324 872..995 620 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:14:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:23:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2226537..2227282 1..746 3730 100 Plus
2L 23513712 2L 2229876..2230413 1167..1704 2690 100 Plus
2L 23513712 2L 2229637..2229813 992..1168 885 100 Plus
2L 23513712 2L 2229264..2229394 744..874 655 100 Plus
2L 23513712 2L 2229455..2229578 872..995 620 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:43:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2226537..2227282 1..746 3730 100 Plus
2L 23513712 2L 2229876..2230413 1167..1704 2690 100 Plus
2L 23513712 2L 2229637..2229813 992..1168 885 100 Plus
2L 23513712 2L 2229264..2229394 744..874 655 100 Plus
2L 23513712 2L 2229455..2229578 872..995 620 100 Plus
Blast to na_te.dros performed on 2019-03-16 20:23:19 has no hits.

LD23816.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:24:09 Download gff for LD23816.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2226265..2226555 1..291 100 == Plus
chr2L 2229384..2229559 993..1168 100 -> Plus
chr2L 2226635..2227009 371..745 99 -> Plus
chr2L 2229012..2229139 746..873 100 -> Plus
chr2L 2229203..2229321 874..992 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:01:03 Download gff for LD23816.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)s5379-RE 1..885 533..1417 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:03:41 Download gff for LD23816.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)s5379-RE 1..885 533..1417 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:22:00 Download gff for LD23816.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)s5379-RD 1..885 533..1417 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:34:17 Download gff for LD23816.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)s5379-RE 1..885 533..1417 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:01:42 Download gff for LD23816.complete
Subject Subject Range Query Range Percent Splice Strand
sau-RD 1..885 533..1417 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:52:25 Download gff for LD23816.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)s5379-RE 15..1718 1..1704 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:03:41 Download gff for LD23816.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)s5379-RE 15..1718 1..1704 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:22:00 Download gff for LD23816.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)s5379-RD 196..1899 1..1704 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:34:18 Download gff for LD23816.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)s5379-RE 15..1718 1..1704 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:01:42 Download gff for LD23816.complete
Subject Subject Range Query Range Percent Splice Strand
sau-RD 196..1899 1..1704 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:24:09 Download gff for LD23816.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2226537..2227281 1..745 100 -> Plus
2L 2229266..2229393 746..873 100 -> Plus
2L 2229457..2229575 874..992 100 -> Plus
2L 2229638..2229813 993..1168 100 -> Plus
2L 2229878..2230413 1169..1704 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:24:09 Download gff for LD23816.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2226537..2227281 1..745 100 -> Plus
2L 2229266..2229393 746..873 100 -> Plus
2L 2229457..2229575 874..992 100 -> Plus
2L 2229638..2229813 993..1168 100 -> Plus
2L 2229878..2230413 1169..1704 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:24:09 Download gff for LD23816.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2226537..2227281 1..745 100 -> Plus
2L 2229266..2229393 746..873 100 -> Plus
2L 2229457..2229575 874..992 100 -> Plus
2L 2229638..2229813 993..1168 100 -> Plus
2L 2229878..2230413 1169..1704 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:22:00 Download gff for LD23816.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2229638..2229813 993..1168 100 -> Plus
arm_2L 2226537..2227281 1..745 100 -> Plus
arm_2L 2229266..2229393 746..873 100 -> Plus
arm_2L 2229457..2229575 874..992 100 -> Plus
arm_2L 2229878..2230413 1169..1704 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:11:10 Download gff for LD23816.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2226537..2227281 1..745 100 -> Plus
2L 2229266..2229393 746..873 100 -> Plus
2L 2229457..2229575 874..992 100 -> Plus
2L 2229638..2229813 993..1168 100 -> Plus
2L 2229878..2230413 1169..1704 100   Plus

LD23816.pep Sequence

Translation from 532 to 1416

> LD23816.pep
MNRSDGLVRRSVKPRENGGAEGGLNANTPDDNQDALDNLKDQEDNIDDGD
SKETRLTLMEEVLLLGLKDKEGYTSFWNDCISSGLRGCILIELGLRGRVM
IEKSGMRRRGLCTRKLILKSDQQTGDVLLDEALKHIKETDPPETVQSWIE
YLSGETWNPLKLRYQLKNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPL
SDNVVKCRLVKKIQDSVLSKWVNDPQRMDKRMLALIFLAHASDVIENAFA
PLNDDDYEVAMKRVRELLDLDFEAESAKPNANEILWAVFMAFTK*

LD23816.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:45:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14611-PA 295 GF14611-PA 1..295 1..294 1520 98.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:45:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24839-PA 294 GG24839-PA 1..294 1..294 1520 98 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:45:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13086-PA 298 GH13086-PA 1..298 1..294 1401 92.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:10
Subject Length Description Subject Range Query Range Score Percent Strand
sau-PE 294 CG7085-PE 1..294 1..294 1520 100 Plus
sau-PA 294 CG7085-PA 1..294 1..294 1520 100 Plus
sau-PD 294 CG7085-PD 1..294 1..294 1520 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:45:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21581-PA 296 GI21581-PA 1..296 1..294 1480 95.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:45:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18710-PA 296 GL18710-PA 1..296 1..294 1469 94.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:45:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25765-PA 151 GA25765-PA 1..147 1..145 686 91.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18323-PA 294 GM18323-PA 1..294 1..294 1539 99.3 Plus
Dsec\GM13603-PA 144 GM13603-PA 1..144 72..215 756 97.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23139-PA 294 GD23139-PA 1..294 1..294 1539 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17492-PA 297 GJ17492-PA 1..297 1..294 1506 97 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15146-PA 296 GK15146-PA 1..296 1..294 1488 95.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:45:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18051-PA 294 GE18051-PA 1..294 1..294 1526 98.6 Plus

LD23816.hyp Sequence

Translation from 532 to 1416

> LD23816.hyp
MNRSDGLVRRSVKPRENGGAEGGLNANTPDDNQDALDNLKDQEDNIDDGD
SKETRLTLMEEVLLLGLKDKEGYTSFWNDCISSGLRGCILIELGLRGRVM
IEKSGMRRRGLCTRKLILKSDQQTGDVLLDEALKHIKETDPPETVQSWIE
YLSGETWNPLKLRYQLKNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPL
SDNVVKCRLVKKIQDSVLSKWVNDPQRMDKRMLALIFLAHASDVIENAFA
PLNDDDYEVAMKRVRELLDLDFEAESAKPNANEILWAVFMAFTK*

LD23816.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
sau-PE 294 CG7085-PE 1..294 1..294 1520 100 Plus
sau-PA 294 CG7085-PA 1..294 1..294 1520 100 Plus
sau-PD 294 CG7085-PD 1..294 1..294 1520 100 Plus