Clone LD23881 Report

Search the DGRC for LD23881

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:238
Well:81
Vector:pOT2
Associated Gene/TranscriptHP1c-RA
Protein status:LD23881.pep: gold
Preliminary Size:1158
Sequenced Size:963

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6990 2001-01-01 Release 2 assignment
CG6990 2001-10-10 Blastp of sequenced clone
CG6990 2003-01-01 Sim4 clustering to Release 3
HP1c 2008-04-29 Release 5.5 accounting
HP1c 2008-08-15 Release 5.9 accounting
HP1c 2008-12-18 5.12 accounting

Clone Sequence Records

LD23881.complete Sequence

963 bp (963 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061322

> LD23881.complete
AAAAAACCAAGCCGATTTTAAATATTGTAAACAATCTTGTAAAAACACAA
TAAAAAATGGTTAAAAACGAGCCCAACTTCGTGGTGGAGCGCATCATGGA
CAAGCGCATTACCAGCGAAGGCAAGGTTGAGTACTACATCAAGTGGCGTG
GCTACACGTCGGCGGACAACACCTGGGAGCCCGAGGAGAACTGCGATTGC
CCGAATCTCATCCAGAAATTCGAGGAGTCGCGCGCCAAGTCCAAGAAGCG
CGGCGAGAAGAAACCCAAGTGCGAAGAGATCCAGAAGCTGCGCGGCTACG
AGCGCGGCTTGGAGCTGGCCGAGATCGTGGGCGCAACGGATGTGACGGGC
GACATCAAGTATCTGGTGCGCTGGCAGTTCTGCGACGAGTTCGACTTGGT
GCCATCGGCACAGATCGTGGAGAAGGATCCGCAAATGCTGATTGACTATT
TCCAGAAGATGGCACCTTACTCCCGTCACATTGCGATGCGAATGAAGGGC
GTGCCGGAGGAGCTGCGTTTGGCGGCCTCGCGCACCAGTTATCCGCACAT
TAGCAGTGCGCCCGTCGAAGTGCCGCCGGAGGTGGATCAGTCCGCTGAGT
TGGCTGGACATCTTGGTGGAATCGCGCCACAGGTGGACCAGGCGCCGCAG
CACCATGCACCCATGGATCTAGCCAATGATACCGACGATTTGGCTAGTGT
TTCGTACTCGATTCCCGTGCCCGGCGTTGGCGACATTGCCATCGATGTGC
CCATGGCGGAAAATCAATAAGGACGCGAGCAGAATCGACTGTTCAGTCTT
TAATCTAAGCCCCTAAGTTTAATTCATACATATGTATAGCTATCTGAAAC
CACTGGGTTCGTCCAGATTCATGTGACCCAACTGGCCGGAGCGAAAGAAG
TGAATGAACTTTCGCGCGGCCGCCAATAAATTTGTCATCACCTCCAAAAA
AAAAAAAAAAAAA

LD23881.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:04:12
Subject Length Description Subject Range Query Range Score Percent Strand
HP1c-RA 978 HP1c-RA 34..978 1..945 4725 100 Plus
HP1c.a 888 HP1c.a 398..888 455..945 2455 100 Plus
HP1c.a 888 HP1c.a 34..398 1..365 1825 100 Plus
CG17141-RA 1102 CG17141-RA 938..1102 946..782 825 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:56:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18569136..18570080 1..945 4575 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:14:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:56:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22745661..22746606 1..946 4730 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:28:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22486492..22487437 1..946 4730 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:56:06 has no hits.

LD23881.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:57:17 Download gff for LD23881.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18569136..18570080 1..945 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:01:14 Download gff for LD23881.complete
Subject Subject Range Query Range Percent Splice Strand
HP1c-RA 1..714 57..770 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:39:11 Download gff for LD23881.complete
Subject Subject Range Query Range Percent Splice Strand
HP1c-RA 1..714 57..770 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:46:02 Download gff for LD23881.complete
Subject Subject Range Query Range Percent Splice Strand
HP1c-RA 1..714 57..770 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:08:00 Download gff for LD23881.complete
Subject Subject Range Query Range Percent Splice Strand
HP1c-RA 1..714 57..770 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:20:56 Download gff for LD23881.complete
Subject Subject Range Query Range Percent Splice Strand
HP1c-RA 1..714 57..770 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:20:26 Download gff for LD23881.complete
Subject Subject Range Query Range Percent Splice Strand
HP1c-RA 34..978 1..945 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:39:11 Download gff for LD23881.complete
Subject Subject Range Query Range Percent Splice Strand
HP1c-RA 34..978 1..945 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:46:02 Download gff for LD23881.complete
Subject Subject Range Query Range Percent Splice Strand
HP1c-RA 34..978 1..945 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:08:00 Download gff for LD23881.complete
Subject Subject Range Query Range Percent Splice Strand
HP1c-RA 34..978 1..945 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:20:56 Download gff for LD23881.complete
Subject Subject Range Query Range Percent Splice Strand
HP1c-RA 42..986 1..945 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:57:17 Download gff for LD23881.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22745661..22746605 1..945 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:57:17 Download gff for LD23881.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22745661..22746605 1..945 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:57:17 Download gff for LD23881.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22745661..22746605 1..945 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:46:02 Download gff for LD23881.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18571383..18572327 1..945 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:44:11 Download gff for LD23881.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22486492..22487436 1..945 100   Plus

LD23881.hyp Sequence

Translation from 56 to 769

> LD23881.hyp
MVKNEPNFVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENCDCPN
LIQKFEESRAKSKKRGEKKPKCEEIQKLRGYERGLELAEIVGATDVTGDI
KYLVRWQFCDEFDLVPSAQIVEKDPQMLIDYFQKMAPYSRHIAMRMKGVP
EELRLAASRTSYPHISSAPVEVPPEVDQSAELAGHLGGIAPQVDQAPQHH
APMDLANDTDDLASVSYSIPVPGVGDIAIDVPMAENQ*

LD23881.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:11:10
Subject Length Description Subject Range Query Range Score Percent Strand
HP1c-PA 237 CG6990-PA 1..237 1..237 1251 100 Plus
HP1b-PB 240 CG7041-PB 4..148 8..134 302 41.8 Plus
HP1b-PC 240 CG7041-PC 4..148 8..134 302 41.8 Plus
HP1b-PA 240 CG7041-PA 4..148 8..134 302 41.8 Plus
Su(var)205-PB 206 CG8409-PB 19..196 3..134 252 31.8 Plus

LD23881.pep Sequence

Translation from 56 to 769

> LD23881.pep
MVKNEPNFVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENCDCPN
LIQKFEESRAKSKKRGEKKPKCEEIQKLRGYERGLELAEIVGATDVTGDI
KYLVRWQFCDEFDLVPSAQIVEKDPQMLIDYFQKMAPYSRHIAMRMKGVP
EELRLAASRTSYPHISSAPVEVPPEVDQSAELAGHLGGIAPQVDQAPQHH
APMDLANDTDDLASVSYSIPVPGVGDIAIDVPMAENQ*

LD23881.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:43:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16710-PA 231 GF16710-PA 1..231 1..237 921 75.2 Plus
Dana\GF19189-PA 227 GF19189-PA 4..152 8..138 300 40.7 Plus
Dana\GF15276-PA 210 GF15276-PA 23..206 8..139 240 31.4 Plus
Dana\GF17204-PA 197 GF17204-PA 50..191 8..140 168 26.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:43:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11164-PA 237 GG11164-PA 1..237 1..237 1143 94.1 Plus
Dere\GG18283-PA 238 GG18283-PA 4..148 8..134 298 41.8 Plus
Dere\GG23468-PA 205 GG23468-PA 23..201 8..139 251 32.2 Plus
Dere\GG16196-PA 170 GG16196-PA 23..165 8..142 165 25.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:43:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18923-PA 238 GH18923-PA 1..238 1..235 810 67.4 Plus
Dgri\GH17802-PA 215 GH17802-PA 4..146 8..133 288 41 Plus
Dgri\GH10251-PA 203 GH10251-PA 23..199 7..139 239 31.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
HP1c-PA 237 CG6990-PA 1..237 1..237 1251 100 Plus
HP1b-PB 240 CG7041-PB 4..148 8..134 302 41.8 Plus
HP1b-PC 240 CG7041-PC 4..148 8..134 302 41.8 Plus
HP1b-PA 240 CG7041-PA 4..148 8..134 302 41.8 Plus
Su(var)205-PB 206 CG8409-PB 19..196 3..134 252 31.8 Plus
Su(var)205-PA 206 CG8409-PA 19..196 3..134 252 31.8 Plus
HP1e-PA 174 CG8120-PA 27..160 8..133 176 30.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:43:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23231-PA 234 GI23231-PA 1..234 1..236 839 68.9 Plus
Dmoj\GI15142-PA 211 GI15142-PA 4..147 8..133 293 41.4 Plus
Dmoj\GI20276-PA 180 GI20276-PA 3..150 7..142 242 36.2 Plus
Dmoj\GI24000-PA 171 GI24000-PA 21..160 8..134 183 29.8 Plus
Dmoj\GI15430-PA 226 GI15430-PA 25..75 8..59 178 57.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:43:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23765-PA 229 GL23765-PA 1..229 1..237 866 70.5 Plus
Dper\GL12976-PA 266 GL12976-PA 4..151 8..138 288 38.9 Plus
Dper\GL19396-PA 205 GL19396-PA 27..201 12..139 225 32.4 Plus
Dper\GL13026-PA 310 GL13026-PA 211..266 79..134 147 42.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:43:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\HP1C-PA 229 GA20011-PA 1..229 1..237 869 70.9 Plus
Dpse\HP1B-PA 234 GA20053-PA 4..151 8..138 288 38.9 Plus
Dpse\HP1A-PA 205 GA21056-PA 27..201 12..139 225 32.4 Plus
Dpse\HP1F-PA 518 GA25885-PA 419..474 79..134 149 42.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:43:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26466-PA 237 GM26466-PA 1..237 1..237 1225 95.4 Plus
Dsec\GM23402-PA 81 GM23402-PA 1..81 1..81 333 79 Plus
Dsec\GM23413-PA 68 GM23413-PA 1..68 127..194 328 91.2 Plus
Dsec\GM13712-PA 240 GM13712-PA 4..152 8..138 304 40.7 Plus
Dsec\GM13138-PA 206 GM13138-PA 24..202 8..139 253 32.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20982-PA 237 GD20982-PA 1..237 1..237 1238 96.6 Plus
Dsim\GD16926-PA 240 GD16926-PA 4..152 8..138 303 40.7 Plus
Dsim\GD22433-PA 206 GD22433-PA 24..202 8..139 251 32.8 Plus
Dsim\GD18604-PA 176 GD18604-PA 27..165 8..138 175 28.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22891-PA 235 GJ22891-PA 1..235 1..236 848 70.2 Plus
Dvir\GJ22004-PA 183 GJ22004-PA 3..149 7..138 245 35.6 Plus
Dvir\Su(var)205-PA 213 GJ17281-PA 24..74 8..59 181 57.7 Plus
Dvir\GJ23632-PA 174 GJ23632-PA 19..158 8..134 176 29.8 Plus
Dvir\GJ19002-PA 128 GJ19002-PA 5..67 72..134 138 39.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:43:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11473-PA 239 GK11473-PA 1..239 1..236 842 69.9 Plus
Dwil\GK16242-PA 277 GK16242-PA 4..150 8..134 298 40.5 Plus
Dwil\GK14980-PA 205 GK14980-PA 21..201 8..139 227 31.9 Plus
Dwil\GK15187-PA 369 GK15187-PA 17..174 8..161 179 29.7 Plus
Dwil\GK13747-PA 176 GK13747-PA 25..173 8..134 166 29.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:43:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10331-PA 238 GE10331-PA 1..238 1..237 1141 95 Plus
Dyak\GE15815-PA 240 GE15815-PA 4..148 8..134 298 41.8 Plus
Dyak\Su(var)205-PA 205 GE11133-PA 23..201 8..139 252 32.8 Plus
Dyak\GE25940-PA 173 GE25940-PA 27..168 8..142 184 28.8 Plus