Clone LD23890 Report

Search the DGRC for LD23890

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:238
Well:90
Vector:pOT2
Associated Gene/TranscriptStart1-RB
Protein status:LD23890.pep: gold
Preliminary Size:3700
Sequenced Size:2343

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3522 2001-01-01 Release 2 assignment
CG3522 2002-05-03 Blastp of sequenced clone
CG3522 2003-01-01 Sim4 clustering to Release 3
Start1 2008-04-29 Release 5.5 accounting
Start1 2008-08-15 Release 5.9 accounting
Start1 2008-12-18 5.12 accounting

Clone Sequence Records

LD23890.complete Sequence

2343 bp (2343 high quality bases) assembled on 2002-05-03

GenBank Submission: AY102683

> LD23890.complete
CTTTTGTTTCGATAGTGCAATTAATATAAATTGGGACAACTGCAAATCTA
ATAGTATTATTAGAACCGGAATTAGTTGTGCACCTTCTAGTATTAGAGAC
TTATTAACATAACCAACCTGTGCCTACCGGAAATATAGAGGTACTTCTCG
CAAATTATGCGGGTTCTTGCAAGATAATACGATACCATTTGTTTATGGCT
GAGTAAAAAAAAAACAAAGAACTCCAGGCTGACGAGTCATTTGTGCGTAT
CGGCACTGAATCTGCTCCAGATTCGAAAACTAGGTTTATTTACATTTGCA
TGCAAAGACATGAGCTAGGCCAAATATAACCGCTCGCCATGTCCAATATG
GATCCAAGTGATGTCCGCAGTACCGCCCAGCTCATCCTGGCCAACGCTCG
GCAGGGAAATAGCGCTTACAACATGCAGTATGATATGTCACGGGCACATT
CCATAAACCTGATTACGGAGGACTTCTTGGCCGGTTATATGCAGGATGGC
AGGATGTCCGTGGTTCGAAGGTTTTTCTGCCTCTTCGTCACATTCGACTT
GGTCTTCGTTTCGCTGCTGTGGCTCATTTGCATTGTGATCAATGGAGACA
ATATATTCACTGCCTTCCACAAACAAATCGTGGAGTACACCATCTACAAA
TCGCTCTTTGATGTTGTGGCAGTCGCTATCTGCCGATTTTTGGTGCTCAT
ATTTTTCTACGCCATATTGTACATCAATCACTGGTCCATCATAGCGCTCT
CTACAAGTGGGTCTTGCTTGTTCCTCATCTCGAAGGTGTTTGTGTTCGAT
TGGCTGGATTCAAAGCAGCAGGTATTTGAGGTAATCCTCATAATAACCTC
GTTCATACTGGCTTGGGGAGAAGCCTGGTTCCTGGACTGTAGGGTGATTC
CTCAAGAGCGACATGCCCAACACTATTTCCGGACTATGACTTCAAATGAT
CGCACACCCATGGAACAGCCTGCCATTTTGATTGAGCAAGAACGGCCTCC
GCAAAGTGTAACCGATTTTTATTCACTCATGGACACGGCTCGTCATTCCG
ACGAGGAGGATGAGTTGGATGATGAGTACACACAAATGGGATTGGATTGC
CTTCGAAAGGCCTACGAGATCATCGAGTCAAGTGACTGGAAGGTGGAAAA
AGTTAACCAGAAAGGCGACACCATACACAGCACTCAGCGCGACAAGATTG
GAAAGATCTACAAGTTGACGGCCCGCATCAAGTATCCTGCAAAGGCTCTG
ATGGAAGATCTGTTCTATCGCATTGAAGACTGTCCCAAGTGGAATCCTGC
TCTTTTGGAGTCCAAGATAGTACGCAAAATCAACTCCTACACCGATATTA
CCTATCAGGTATCCGTGGGCGGAGGAGGTGGCATGGTGAAGAGCCGCGAC
TTCGTGAACTTGCGGTCTTGTAGGCTCTTTTACAATGGTCAAATCTGCGA
TGACGATGAGACGGCTCAGCTCAGCAGCGATGATGGGAACAGCAGTCTAA
ATCGGTCTTGCGAGGGTAGTGTTAGTACCATTTCCGATGGTGACTCAAAC
ACCCCACTGCTGCCCAGTAGCGTGTCTAGTTGCAAGGCAACGTTTCCCAC
TTCATCCAAGGGAGCCGCTATGCCTTTTGACACCCTGGGCAACAGCTTGG
GCGCCAAGAGCCTAGGTCCCATCGTGAACTTTGACGAGGAGCCACCGCCA
TTGGATCAGGACGAGTTCGAGGATGCTAAGGACAAGGTCGACGGCGAAGC
GAATAACATGACGAAACCAAATGTACCCAGCGTGGGAAAAACCAAGGACA
GGGTTTGGGTCACTTCGGCGGTTAGTGTGCAATATGCTGCCGTTCCACCT
TCACCCAAATACACAAGTCGGTTGACTCTTCAATTTTCAGAGGGCAGAAC
ATTGTCAGTGGGTTTGCGTTTCGTGAAATCGTTGGAAAATCGGATAGCTG
CATTGTGGAGTGGGTGCTTTGCCTAGACCTAAAAGGCTATATTCCTCGCT
ATGTCCTGGATGCAGCCCTCACCTCGTCCATGACCGACTACATTAGCAAT
CTGCGCAAGCATGTCAACGAACTGAGGCAGAAGGGGCGTGGTCGAGCCCC
CAGGACCCACTAGGAAATCAGTAATCCGTATTTTAATTTAAATCCCATTG
TATCTCAAGCGAGTGCTGTTCGCAGCAAGGTATCTAATAGAATATTTCAA
TAATTTGAAGCAGGAGAGCGAGTTCAGTGCTGTAAGTTTATTGAGTATTT
TATGTATATGTATGGCATAAGTTCTATGTACCTATATGCACGGCTTACAT
TATAAATTTTATACATGACTTTTTTAAAAAAAAAAAAAAAAAA

LD23890.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
Start1-RB 2345 Start1-RB 18..2344 1..2327 11635 100 Plus
Start1-RA 2411 Start1-RA 48..1914 1..1867 9335 100 Plus
Start1.c 2470 Start1.c 412..1973 306..1867 7810 100 Plus
Start1.c 2470 Start1.c 1972..2410 1889..2327 2195 100 Plus
Start1-RA 2411 Start1-RA 1913..2351 1889..2327 2195 100 Plus
Start1.c 2470 Start1.c 49..355 1..307 1535 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:25:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20462486..20463027 1326..1867 2680 99.6 Plus
chr2R 21145070 chr2R 20463286..20463596 2015..2325 1525 99.4 Plus
chr2R 21145070 chr2R 20460514..20460820 1..307 1520 99.7 Plus
chr2R 21145070 chr2R 20461281..20461440 587..746 785 99.4 Plus
chr2R 21145070 chr2R 20462113..20462267 1067..1221 775 100 Plus
chr2R 21145070 chr2R 20463071..20463220 1866..2015 750 100 Plus
chr2R 21145070 chr2R 20461071..20461219 439..587 745 100 Plus
chr2R 21145070 chr2R 20461797..20461931 934..1068 675 100 Plus
chr2R 21145070 chr2R 20460877..20461009 306..438 665 100 Plus
chr2R 21145070 chr2R 20461611..20461743 801..933 665 100 Plus
chr2R 21145070 chr2R 20462320..20462425 1220..1325 530 100 Plus
chr2R 21145070 chr2R 20461495..20461549 746..800 275 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:14:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:25:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24576566..24577107 1326..1867 2710 100 Plus
2R 25286936 2R 24577366..24577678 2015..2327 1565 100 Plus
2R 25286936 2R 24574594..24574900 1..307 1535 100 Plus
2R 25286936 2R 24575361..24575520 587..746 800 100 Plus
2R 25286936 2R 24576193..24576347 1067..1221 775 100 Plus
2R 25286936 2R 24577151..24577300 1866..2015 750 100 Plus
2R 25286936 2R 24575151..24575299 439..587 745 100 Plus
2R 25286936 2R 24575877..24576011 934..1068 675 100 Plus
2R 25286936 2R 24574957..24575089 306..438 665 100 Plus
2R 25286936 2R 24575691..24575823 801..933 665 100 Plus
2R 25286936 2R 24576400..24576505 1220..1325 530 100 Plus
2R 25286936 2R 24575575..24575629 746..800 275 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:39:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24577765..24578306 1326..1867 2710 100 Plus
2R 25260384 2R 24578565..24578877 2015..2327 1565 100 Plus
2R 25260384 2R 24575793..24576099 1..307 1535 100 Plus
2R 25260384 2R 24576560..24576719 587..746 800 100 Plus
2R 25260384 2R 24577392..24577546 1067..1221 775 100 Plus
2R 25260384 2R 24578350..24578499 1866..2015 750 100 Plus
2R 25260384 2R 24576350..24576498 439..587 745 100 Plus
2R 25260384 2R 24577076..24577210 934..1068 675 100 Plus
2R 25260384 2R 24576890..24577022 801..933 665 100 Plus
2R 25260384 2R 24576156..24576288 306..438 665 100 Plus
2R 25260384 2R 24577599..24577704 1220..1325 530 100 Plus
2R 25260384 2R 24576774..24576828 746..800 275 100 Plus
Blast to na_te.dros performed on 2019-03-15 18:25:13 has no hits.

LD23890.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:25:58 Download gff for LD23890.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20460514..20460820 1..307 99 -> Plus
chr2R 20460879..20461009 308..438 100 -> Plus
chr2R 20461071..20461219 439..587 100 -> Plus
chr2R 20461282..20461440 588..746 99 -> Plus
chr2R 20461496..20461549 747..800 100 -> Plus
chr2R 20461611..20461743 801..933 100 -> Plus
chr2R 20461797..20461930 934..1067 100 -> Plus
chr2R 20462114..20462266 1068..1220 100 -> Plus
chr2R 20462321..20462425 1221..1325 100 -> Plus
chr2R 20462486..20463027 1326..1867 99 -> Plus
chr2R 20463073..20463219 1868..2014 100 -> Plus
chr2R 20463286..20463596 2015..2325 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:01:18 Download gff for LD23890.complete
Subject Subject Range Query Range Percent Splice Strand
Start1-RB 1..1638 339..1976 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:52:46 Download gff for LD23890.complete
Subject Subject Range Query Range Percent Splice Strand
Start1-RB 1..1638 339..1976 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:03:00 Download gff for LD23890.complete
Subject Subject Range Query Range Percent Splice Strand
Start1-RB 1..1638 339..1976 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:45:20 Download gff for LD23890.complete
Subject Subject Range Query Range Percent Splice Strand
Start1-RB 1..1638 339..1976 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:02:20 Download gff for LD23890.complete
Subject Subject Range Query Range Percent Splice Strand
Start1-RB 1..1638 339..1976 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:31:00 Download gff for LD23890.complete
Subject Subject Range Query Range Percent Splice Strand
Start1-RB 18..2342 1..2325 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:52:46 Download gff for LD23890.complete
Subject Subject Range Query Range Percent Splice Strand
Start1-RB 39..2363 1..2325 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:03:00 Download gff for LD23890.complete
Subject Subject Range Query Range Percent Splice Strand
Start1-RB 36..2360 1..2325 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:45:20 Download gff for LD23890.complete
Subject Subject Range Query Range Percent Splice Strand
Start1-RB 18..2342 1..2325 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:02:20 Download gff for LD23890.complete
Subject Subject Range Query Range Percent Splice Strand
Start1-RB 36..2360 1..2325 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:25:58 Download gff for LD23890.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24576401..24576505 1221..1325 100 -> Plus
2R 24574594..24574900 1..307 100 -> Plus
2R 24574959..24575089 308..438 100 -> Plus
2R 24575151..24575299 439..587 100 -> Plus
2R 24575362..24575520 588..746 100 -> Plus
2R 24575576..24575629 747..800 100 -> Plus
2R 24575691..24575823 801..933 100 -> Plus
2R 24575877..24576010 934..1067 100 -> Plus
2R 24576194..24576346 1068..1220 100 -> Plus
2R 24576566..24577107 1326..1867 100 -> Plus
2R 24577153..24577299 1868..2014 100 -> Plus
2R 24577366..24577676 2015..2325 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:25:58 Download gff for LD23890.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24576401..24576505 1221..1325 100 -> Plus
2R 24574594..24574900 1..307 100 -> Plus
2R 24574959..24575089 308..438 100 -> Plus
2R 24575151..24575299 439..587 100 -> Plus
2R 24575362..24575520 588..746 100 -> Plus
2R 24575576..24575629 747..800 100 -> Plus
2R 24575691..24575823 801..933 100 -> Plus
2R 24575877..24576010 934..1067 100 -> Plus
2R 24576194..24576346 1068..1220 100 -> Plus
2R 24576566..24577107 1326..1867 100 -> Plus
2R 24577153..24577299 1868..2014 100 -> Plus
2R 24577366..24577676 2015..2325 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:25:58 Download gff for LD23890.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24576401..24576505 1221..1325 100 -> Plus
2R 24574594..24574900 1..307 100 -> Plus
2R 24574959..24575089 308..438 100 -> Plus
2R 24575151..24575299 439..587 100 -> Plus
2R 24575362..24575520 588..746 100 -> Plus
2R 24575576..24575629 747..800 100 -> Plus
2R 24575691..24575823 801..933 100 -> Plus
2R 24575877..24576010 934..1067 100 -> Plus
2R 24576194..24576346 1068..1220 100 -> Plus
2R 24576566..24577107 1326..1867 100 -> Plus
2R 24577153..24577299 1868..2014 100 -> Plus
2R 24577366..24577676 2015..2325 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:03:00 Download gff for LD23890.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20463099..20463152 747..800 100 -> Plus
arm_2R 20463214..20463346 801..933 100 -> Plus
arm_2R 20463400..20463533 934..1067 100 -> Plus
arm_2R 20463717..20463869 1068..1220 100 -> Plus
arm_2R 20463924..20464028 1221..1325 100 -> Plus
arm_2R 20462885..20463043 588..746 100 -> Plus
arm_2R 20462117..20462423 1..307 100 -> Plus
arm_2R 20462482..20462612 308..438 100 -> Plus
arm_2R 20462674..20462822 439..587 100 -> Plus
arm_2R 20464089..20464630 1326..1867 100 -> Plus
arm_2R 20464676..20464822 1868..2014 100 -> Plus
arm_2R 20464889..20465199 2015..2325 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:17:47 Download gff for LD23890.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24576579..24576737 588..746 100 -> Plus
2R 24576793..24576846 747..800 100 -> Plus
2R 24576908..24577040 801..933 100 -> Plus
2R 24577094..24577227 934..1067 100 -> Plus
2R 24577411..24577563 1068..1220 100 -> Plus
2R 24577618..24577722 1221..1325 100 -> Plus
2R 24575811..24576117 1..307 100 -> Plus
2R 24576176..24576306 308..438 100 -> Plus
2R 24576368..24576516 439..587 100 -> Plus
2R 24577783..24578324 1326..1867 100 -> Plus
2R 24578370..24578516 1868..2014 100 -> Plus
2R 24578583..24578893 2015..2325 100   Plus

LD23890.pep Sequence

Translation from 338 to 1975

> LD23890.pep
MSNMDPSDVRSTAQLILANARQGNSAYNMQYDMSRAHSINLITEDFLAGY
MQDGRMSVVRRFFCLFVTFDLVFVSLLWLICIVINGDNIFTAFHKQIVEY
TIYKSLFDVVAVAICRFLVLIFFYAILYINHWSIIALSTSGSCLFLISKV
FVFDWLDSKQQVFEVILIITSFILAWGEAWFLDCRVIPQERHAQHYFRTM
TSNDRTPMEQPAILIEQERPPQSVTDFYSLMDTARHSDEEDELDDEYTQM
GLDCLRKAYEIIESSDWKVEKVNQKGDTIHSTQRDKIGKIYKLTARIKYP
AKALMEDLFYRIEDCPKWNPALLESKIVRKINSYTDITYQVSVGGGGGMV
KSRDFVNLRSCRLFYNGQICDDDETAQLSSDDGNSSLNRSCEGSVSTISD
GDSNTPLLPSSVSSCKATFPTSSKGAAMPFDTLGNSLGAKSLGPIVNFDE
EPPPLDQDEFEDAKDKVDGEANNMTKPNVPSVGKTKDRVWVTSAVSVQYA
AVPPSPKYTSRLTLQFSEGRTLSVGLRFVKSLENRIAALWSGCFA*

LD23890.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:04:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13632-PA 582 GF13632-PA 1..508 1..509 2166 84.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:04:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22985-PA 583 GG22985-PA 1..509 1..509 2665 96.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:05:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20005-PA 585 GH20005-PA 1..517 1..509 1853 70.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
Start1-PB 545 CG3522-PB 1..545 1..545 2842 100 Plus
Start1-PC 583 CG3522-PC 1..509 1..509 2662 100 Plus
Start1-PA 583 CG3522-PA 1..509 1..509 2662 100 Plus
Start1-PD 343 CG3522-PD 4..269 244..509 1398 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:05:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19186-PA 592 GI19186-PA 1..523 1..508 1826 70 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:05:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10224-PA 585 GL10224-PA 1..511 1..509 2248 83 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:05:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24124-PA 585 GA24124-PA 1..511 1..509 2250 83 Plus
Dpse\GA24124-PB 557 GA24124-PB 1..511 1..509 2248 83 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:05:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11878-PA 583 GM11878-PA 1..509 1..509 2702 97.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:05:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11876-PA 583 GD11876-PA 1..509 1..509 2696 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:05:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20248-PA 590 GJ20248-PA 1..522 1..509 1920 73.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:05:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19709-PA 570 GK19709-PA 1..509 1..509 1911 72.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:05:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14422-PA 583 GE14422-PA 1..509 1..509 2669 96.9 Plus

LD23890.hyp Sequence

Translation from 338 to 1975

> LD23890.hyp
MSNMDPSDVRSTAQLILANARQGNSAYNMQYDMSRAHSINLITEDFLAGY
MQDGRMSVVRRFFCLFVTFDLVFVSLLWLICIVINGDNIFTAFHKQIVEY
TIYKSLFDVVAVAICRFLVLIFFYAILYINHWSIIALSTSGSCLFLISKV
FVFDWLDSKQQVFEVILIITSFILAWGEAWFLDCRVIPQERHAQHYFRTM
TSNDRTPMEQPAILIEQERPPQSVTDFYSLMDTARHSDEEDELDDEYTQM
GLDCLRKAYEIIESSDWKVEKVNQKGDTIHSTQRDKIGKIYKLTARIKYP
AKALMEDLFYRIEDCPKWNPALLESKIVRKINSYTDITYQVSVGGGGGMV
KSRDFVNLRSCRLFYNGQICDDDETAQLSSDDGNSSLNRSCEGSVSTISD
GDSNTPLLPSSVSSCKATFPTSSKGAAMPFDTLGNSLGAKSLGPIVNFDE
EPPPLDQDEFEDAKDKVDGEANNMTKPNVPSVGKTKDRVWVTSAVSVQYA
AVPPSPKYTSRLTLQFSEGRTLSVGLRFVKSLENRIAALWSGCFA*

LD23890.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:22:20
Subject Length Description Subject Range Query Range Score Percent Strand
Start1-PB 545 CG3522-PB 1..545 1..545 2842 100 Plus
Start1-PC 583 CG3522-PC 1..509 1..509 2662 100 Plus
Start1-PA 583 CG3522-PA 1..509 1..509 2662 100 Plus
Start1-PD 343 CG3522-PD 4..269 244..509 1398 100 Plus