BDGP Sequence Production Resources |
Search the DGRC for LD23958
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 239 |
Well: | 58 |
Vector: | pOT2 |
Associated Gene/Transcript | RpS13-RA |
Protein status: | LD23958.pep: gold |
Preliminary Size: | 596 |
Sequenced Size: | 603 |
Gene | Date | Evidence |
---|---|---|
CG13389 | 2001-01-01 | Release 2 assignment |
CG13389 | 2001-09-19 | Blastp of sequenced clone |
CG13389 | 2003-01-01 | Sim4 clustering to Release 3 |
RpS13 | 2008-04-29 | Release 5.5 accounting |
RpS13 | 2008-08-15 | Release 5.9 accounting |
RpS13 | 2008-12-18 | 5.12 accounting |
603 bp (603 high quality bases) assembled on 2001-09-19
GenBank Submission: AY058536
> LD23958.complete ATGGGTCGTATGCACGCTCCTGGCAAGGGTATTTCCCAATCAGCCCTCCC CTACAGACGCACTGTCCCATCCTGGCTGAAACTGAACGCAGATGATGTCA AGGAGCAGATTAAGAAGCTGGGCAAGAAGGGTCTGACTCCCTCCAAAATC GGCATCATCCTGCGTGACTCGCACGGAGTTGCCCAGGTGCGTTTCGTCAA CGGAAACAAGATCCTGCGCATCATGAAGTCGGTGGGTCTGAAGCCCGACA TTCCCGAGGATCTGTACCACATGATCAAGAAGGCCGTCGCCATCCGCAAG CACTTGGAGCGCAACCGCAAGGACAAGGACGGCAAGTTCCGTCTGATTCT GGTCGAGTCCAGGATCCACCGCCTGGCCCGCTACTACAAGACCAAGAGCG TCCTGCCCCCCAACTGGAAATACGAGTCGAGCACTGCCTCCGCCCTGGTT GCCTAAGTTCTTGATTCGCTAGTTGGTAGTTTGTTTTCAAGTCTTGCGGG GTCCTACATTTCCATCAATGTACAACCAATAAACCCAACAAATAAAACTG GAAATCGGAACTATTTTATAGACTAAACAAAAAAAAAAAAAAAAAAAAAA AAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 8362615..8363041 | 152..578 | 100 | <- | Minus |
chr2L | 8363104..8363231 | 24..151 | 100 | <- | Minus |
chr2L | 8363457..8363479 | 1..23 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS13-RB | 1..456 | 1..456 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS13-RB | 1..456 | 1..456 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS13-RA | 1..456 | 1..456 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS13-RB | 1..456 | 1..456 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS13-RA | 1..456 | 1..456 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS13-RB | 31..608 | 1..578 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS13-RB | 31..608 | 1..578 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS13-RA | 47..624 | 1..578 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS13-RB | 31..608 | 1..578 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS13-RA | 47..624 | 1..578 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8363699..8364125 | 152..578 | 100 | <- | Minus |
2L | 8364188..8364315 | 24..151 | 100 | <- | Minus |
2L | 8364541..8364563 | 1..23 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8363699..8364125 | 152..578 | 100 | <- | Minus |
2L | 8364188..8364315 | 24..151 | 100 | <- | Minus |
2L | 8364541..8364563 | 1..23 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8363699..8364125 | 152..578 | 100 | <- | Minus |
2L | 8364188..8364315 | 24..151 | 100 | <- | Minus |
2L | 8364541..8364563 | 1..23 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 8363699..8364125 | 152..578 | 100 | <- | Minus |
arm_2L | 8364188..8364315 | 24..151 | 100 | <- | Minus |
arm_2L | 8364541..8364563 | 1..23 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8363699..8364125 | 152..578 | 100 | <- | Minus |
2L | 8364188..8364315 | 24..151 | 100 | <- | Minus |
2L | 8364541..8364563 | 1..23 | 100 | Minus |
Translation from 0 to 455
> LD23958.pep MGRMHAPGKGISQSALPYRRTVPSWLKLNADDVKEQIKKLGKKGLTPSKI GIILRDSHGVAQVRFVNGNKILRIMKSVGLKPDIPEDLYHMIKKAVAIRK HLERNRKDKDGKFRLILVESRIHRLARYYKTKSVLPPNWKYESSTASALV A*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14686-PA | 151 | GF14686-PA | 1..151 | 1..151 | 775 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23452-PA | 151 | GG23452-PA | 1..151 | 1..151 | 775 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14648-PA | 151 | GH14648-PA | 1..151 | 1..151 | 770 | 98 | Plus |
Dgri\GH10885-PA | 151 | GH10885-PA | 1..151 | 1..151 | 763 | 96.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS13-PC | 151 | CG13389-PC | 1..151 | 1..151 | 774 | 100 | Plus |
RpS13-PB | 151 | CG13389-PB | 1..151 | 1..151 | 774 | 100 | Plus |
RpS13-PA | 151 | CG13389-PA | 1..151 | 1..151 | 774 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23672-PA | 151 | GI23672-PA | 1..151 | 1..151 | 779 | 99.3 | Plus |
Dmoj\GI13008-PA | 151 | GI13008-PA | 1..151 | 1..151 | 779 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18905-PA | 151 | GL18905-PA | 1..151 | 1..151 | 775 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12248-PA | 151 | GA12248-PA | 1..151 | 1..151 | 775 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM13013-PA | 151 | GM13013-PA | 1..151 | 1..151 | 775 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD22414-PA | 151 | GD22414-PA | 1..151 | 1..151 | 775 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23232-PA | 151 | GJ23232-PA | 1..151 | 1..151 | 779 | 99.3 | Plus |
Dvir\GJ11538-PA | 151 | GJ11538-PA | 1..151 | 1..151 | 775 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13532-PA | 151 | GK13532-PA | 1..151 | 1..151 | 773 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\RpS13-PA | 151 | GE11036-PA | 1..151 | 1..151 | 775 | 98.7 | Plus |
Translation from 1 to 455
> LD23958.hyp MGRMHAPGKGISQSALPYRRTVPSWLKLNADDVKEQIKKLGKKGLTPSKI GIILRDSHGVAQVRFVNGNKILRIMKSVGLKPDIPEDLYHMIKKAVAIRK HLERNRKDKDGKFRLILVESRIHRLARYYKTKSVLPPNWKYESSTASALV A*