Clone LD23958 Report

Search the DGRC for LD23958

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:239
Well:58
Vector:pOT2
Associated Gene/TranscriptRpS13-RA
Protein status:LD23958.pep: gold
Preliminary Size:596
Sequenced Size:603

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13389 2001-01-01 Release 2 assignment
CG13389 2001-09-19 Blastp of sequenced clone
CG13389 2003-01-01 Sim4 clustering to Release 3
RpS13 2008-04-29 Release 5.5 accounting
RpS13 2008-08-15 Release 5.9 accounting
RpS13 2008-12-18 5.12 accounting

Clone Sequence Records

LD23958.complete Sequence

603 bp (603 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058536

> LD23958.complete
ATGGGTCGTATGCACGCTCCTGGCAAGGGTATTTCCCAATCAGCCCTCCC
CTACAGACGCACTGTCCCATCCTGGCTGAAACTGAACGCAGATGATGTCA
AGGAGCAGATTAAGAAGCTGGGCAAGAAGGGTCTGACTCCCTCCAAAATC
GGCATCATCCTGCGTGACTCGCACGGAGTTGCCCAGGTGCGTTTCGTCAA
CGGAAACAAGATCCTGCGCATCATGAAGTCGGTGGGTCTGAAGCCCGACA
TTCCCGAGGATCTGTACCACATGATCAAGAAGGCCGTCGCCATCCGCAAG
CACTTGGAGCGCAACCGCAAGGACAAGGACGGCAAGTTCCGTCTGATTCT
GGTCGAGTCCAGGATCCACCGCCTGGCCCGCTACTACAAGACCAAGAGCG
TCCTGCCCCCCAACTGGAAATACGAGTCGAGCACTGCCTCCGCCCTGGTT
GCCTAAGTTCTTGATTCGCTAGTTGGTAGTTTGTTTTCAAGTCTTGCGGG
GTCCTACATTTCCATCAATGTACAACCAATAAACCCAACAAATAAAACTG
GAAATCGGAACTATTTTATAGACTAAACAAAAAAAAAAAAAAAAAAAAAA
AAA

LD23958.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:06:36
Subject Length Description Subject Range Query Range Score Percent Strand
RpS13-RA 934 RpS13-RA 204..784 1..581 2905 100 Plus
RpS13-RB 934 RpS13-RB 204..784 1..581 2905 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:05:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8362615..8363042 578..151 2140 100 Minus
chr2L 23010047 chr2L 8363103..8363232 152..23 650 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:14:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:05:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8363696..8364126 581..151 2155 100 Minus
2L 23513712 2L 8364187..8364316 152..23 650 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8363696..8364126 581..151 2155 100 Minus
2L 23513712 2L 8364187..8364316 152..23 650 100 Minus
Blast to na_te.dros performed on 2019-03-16 04:05:21 has no hits.

LD23958.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:06:35 Download gff for LD23958.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8362615..8363041 152..578 100 <- Minus
chr2L 8363104..8363231 24..151 100 <- Minus
chr2L 8363457..8363479 1..23 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:01:26 Download gff for LD23958.complete
Subject Subject Range Query Range Percent Splice Strand
RpS13-RB 1..456 1..456 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:49:20 Download gff for LD23958.complete
Subject Subject Range Query Range Percent Splice Strand
RpS13-RB 1..456 1..456 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:15:44 Download gff for LD23958.complete
Subject Subject Range Query Range Percent Splice Strand
RpS13-RA 1..456 1..456 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:41:59 Download gff for LD23958.complete
Subject Subject Range Query Range Percent Splice Strand
RpS13-RB 1..456 1..456 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:25:51 Download gff for LD23958.complete
Subject Subject Range Query Range Percent Splice Strand
RpS13-RA 1..456 1..456 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:26:18 Download gff for LD23958.complete
Subject Subject Range Query Range Percent Splice Strand
RpS13-RB 31..608 1..578 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:49:20 Download gff for LD23958.complete
Subject Subject Range Query Range Percent Splice Strand
RpS13-RB 31..608 1..578 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:15:44 Download gff for LD23958.complete
Subject Subject Range Query Range Percent Splice Strand
RpS13-RA 47..624 1..578 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:42:00 Download gff for LD23958.complete
Subject Subject Range Query Range Percent Splice Strand
RpS13-RB 31..608 1..578 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:25:51 Download gff for LD23958.complete
Subject Subject Range Query Range Percent Splice Strand
RpS13-RA 47..624 1..578 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:06:35 Download gff for LD23958.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8363699..8364125 152..578 100 <- Minus
2L 8364188..8364315 24..151 100 <- Minus
2L 8364541..8364563 1..23 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:06:35 Download gff for LD23958.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8363699..8364125 152..578 100 <- Minus
2L 8364188..8364315 24..151 100 <- Minus
2L 8364541..8364563 1..23 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:06:35 Download gff for LD23958.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8363699..8364125 152..578 100 <- Minus
2L 8364188..8364315 24..151 100 <- Minus
2L 8364541..8364563 1..23 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:15:44 Download gff for LD23958.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8363699..8364125 152..578 100 <- Minus
arm_2L 8364188..8364315 24..151 100 <- Minus
arm_2L 8364541..8364563 1..23 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:14:13 Download gff for LD23958.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8363699..8364125 152..578 100 <- Minus
2L 8364188..8364315 24..151 100 <- Minus
2L 8364541..8364563 1..23 100   Minus

LD23958.pep Sequence

Translation from 0 to 455

> LD23958.pep
MGRMHAPGKGISQSALPYRRTVPSWLKLNADDVKEQIKKLGKKGLTPSKI
GIILRDSHGVAQVRFVNGNKILRIMKSVGLKPDIPEDLYHMIKKAVAIRK
HLERNRKDKDGKFRLILVESRIHRLARYYKTKSVLPPNWKYESSTASALV
A*

LD23958.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14686-PA 151 GF14686-PA 1..151 1..151 775 98.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:36:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23452-PA 151 GG23452-PA 1..151 1..151 775 98.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14648-PA 151 GH14648-PA 1..151 1..151 770 98 Plus
Dgri\GH10885-PA 151 GH10885-PA 1..151 1..151 763 96.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:14
Subject Length Description Subject Range Query Range Score Percent Strand
RpS13-PC 151 CG13389-PC 1..151 1..151 774 100 Plus
RpS13-PB 151 CG13389-PB 1..151 1..151 774 100 Plus
RpS13-PA 151 CG13389-PA 1..151 1..151 774 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23672-PA 151 GI23672-PA 1..151 1..151 779 99.3 Plus
Dmoj\GI13008-PA 151 GI13008-PA 1..151 1..151 779 99.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18905-PA 151 GL18905-PA 1..151 1..151 775 98.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12248-PA 151 GA12248-PA 1..151 1..151 775 98.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13013-PA 151 GM13013-PA 1..151 1..151 775 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22414-PA 151 GD22414-PA 1..151 1..151 775 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:36:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23232-PA 151 GJ23232-PA 1..151 1..151 779 99.3 Plus
Dvir\GJ11538-PA 151 GJ11538-PA 1..151 1..151 775 98.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:36:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13532-PA 151 GK13532-PA 1..151 1..151 773 98 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:36:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpS13-PA 151 GE11036-PA 1..151 1..151 775 98.7 Plus

LD23958.hyp Sequence

Translation from 1 to 455

> LD23958.hyp
MGRMHAPGKGISQSALPYRRTVPSWLKLNADDVKEQIKKLGKKGLTPSKI
GIILRDSHGVAQVRFVNGNKILRIMKSVGLKPDIPEDLYHMIKKAVAIRK
HLERNRKDKDGKFRLILVESRIHRLARYYKTKSVLPPNWKYESSTASALV
A*

LD23958.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:32:57
Subject Length Description Subject Range Query Range Score Percent Strand
RpS13-PC 151 CG13389-PC 1..151 1..151 774 100 Plus
RpS13-PB 151 CG13389-PB 1..151 1..151 774 100 Plus
RpS13-PA 151 CG13389-PA 1..151 1..151 774 100 Plus