Clone LD23959 Report

Search the DGRC for LD23959

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:239
Well:59
Vector:pOT2
Associated Gene/Transcripteca-RA
Protein status:LD23959.pep: gold
Preliminary Size:3700
Sequenced Size:924

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9443 2001-01-01 Release 2 assignment
CG33104 2001-07-04 Blastp of sequenced clone
CG33104 2003-01-01 Sim4 clustering to Release 3
eca 2008-04-29 Release 5.5 accounting
eca 2008-08-15 Release 5.9 accounting
eca 2008-12-18 5.12 accounting

Clone Sequence Records

LD23959.complete Sequence

924 bp (924 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051693

> LD23959.complete
CGGCGAGCTTAACTTTATTAAAGAACTACTCGAAAAAGTCACTGCAAATA
GCCGAAAATGCGCGACCAATTCATCAGCCTGGCCCTGATTCTGTGCGTCC
TGCACAGCGCCTGCGGCTTGTACTTCCACATATCGGAGACGGAGCGCAAG
TGCTTCATCGAGGAGGTTCCCGACGAGACAACTGTGATTGTTAACTACAA
GGTAGAGCTGTATGATCCGCGCTCTAATGGATTCATGCCCTCGTCGCCCG
GAATCGGCATGCATGTGGAAGTACGCGACAGCGACGACAAGATTGTGCTG
TCCCGCGTGTACAGCTCACAGGGCCGCATCTCGTTCACCTCGCACACTCC
TGGCGAGCACGTCATCTGCATGTTCTCGAACAGCACCGCGTGGTTCAGTG
GTGCCCAGCTGCGTGTTCACCTGGACATCCAGGTGGGAGAGCACGCTATC
GACTACGCCCATGTGGCGCAGAAGGAGAAACTGACTGAGCTGCAGCTGCG
CATCCGCCAGCTACTTGACCAGGTGGAGCAGATCACCAAGGAGCAGAACT
ACCAGCGATACCGCGAGGAGCGGTTCCGTCACACCAGCGAGAGCACCAAC
TCCCGCGTGCTCTGGTGGTCGCTGGCCCAGACCGTCGTCTTGGTTTGCAT
GGGCTTCTGGCAGATGCGTCATCTCAAGAGCTTCTTTGAGGCCAAGAAAC
TGGTGTGAGGTGCTCCGGGGCTAGGGCATCATCAGCACCACTGGCCAACC
ACTGGCCTCATTGTTCCGTGTGTTTCCCTCATTTGGCAGGAATTGCGAAT
TTCATCGATGGATCGTCATCCACCCAACCAGCCACTGGCCTCGACTCCAA
GCACTTCTAGTTGTAATTTCTTGTGCGTAATTTAATAAAATCCATTGTAC
AAAACGAAAAAAAAAAAAAAAAAA

LD23959.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:32:45
Subject Length Description Subject Range Query Range Score Percent Strand
eca-RA 1280 eca-RA 134..1040 1..907 4535 100 Plus
p24-2-RA 830 p24-2-RA 39..700 1..662 3295 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:24:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5510293..5511009 906..190 3570 99.9 Minus
chr3R 27901430 chr3R 5517857..5518329 662..190 2365 100 Minus
chr3R 27901430 chr3R 5511071..5511260 190..1 950 100 Minus
chr3R 27901430 chr3R 5518391..5518580 190..1 935 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:14:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:24:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9684468..9685185 907..190 3590 100 Minus
3R 32079331 3R 9692033..9692505 662..190 2365 100 Minus
3R 32079331 3R 9685247..9685436 190..1 950 100 Minus
3R 32079331 3R 9692567..9692756 190..1 935 99.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:54:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9425299..9426016 907..190 3590 100 Minus
3R 31820162 3R 9432864..9433336 662..190 2365 100 Minus
3R 31820162 3R 9426078..9426267 190..1 950 100 Minus
3R 31820162 3R 9433398..9433587 190..1 935 99.4 Minus
Blast to na_te.dros performed on 2019-03-15 22:24:14 has no hits.

LD23959.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:24:59 Download gff for LD23959.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5510293..5511008 191..906 99 <- Minus
chr3R 5511071..5511260 1..190 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:01:27 Download gff for LD23959.complete
Subject Subject Range Query Range Percent Splice Strand
eca-RA 1..651 58..708 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:21:56 Download gff for LD23959.complete
Subject Subject Range Query Range Percent Splice Strand
eca-RA 1..651 58..708 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:18:17 Download gff for LD23959.complete
Subject Subject Range Query Range Percent Splice Strand
eca-RA 1..651 58..708 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:54:33 Download gff for LD23959.complete
Subject Subject Range Query Range Percent Splice Strand
eca-RA 1..651 58..708 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:21:17 Download gff for LD23959.complete
Subject Subject Range Query Range Percent Splice Strand
eca-RA 1..651 58..708 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:19:02 Download gff for LD23959.complete
Subject Subject Range Query Range Percent Splice Strand
eca-RA 96..1001 1..906 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:21:56 Download gff for LD23959.complete
Subject Subject Range Query Range Percent Splice Strand
eca-RA 96..1001 1..906 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:18:17 Download gff for LD23959.complete
Subject Subject Range Query Range Percent Splice Strand
eca-RA 41..946 1..906 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:54:33 Download gff for LD23959.complete
Subject Subject Range Query Range Percent Splice Strand
eca-RA 96..1001 1..906 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:21:17 Download gff for LD23959.complete
Subject Subject Range Query Range Percent Splice Strand
eca-RA 41..946 1..906 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:24:59 Download gff for LD23959.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9684469..9685184 191..906 100 <- Minus
3R 9685247..9685436 1..190 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:24:59 Download gff for LD23959.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9684469..9685184 191..906 100 <- Minus
3R 9685247..9685436 1..190 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:24:59 Download gff for LD23959.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9684469..9685184 191..906 100 <- Minus
3R 9685247..9685436 1..190 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:18:17 Download gff for LD23959.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5510191..5510906 191..906 100 <- Minus
arm_3R 5510969..5511158 1..190 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:32:15 Download gff for LD23959.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9425300..9426015 191..906 100 <- Minus
3R 9426078..9426267 1..190 100   Minus

LD23959.pep Sequence

Translation from 57 to 707

> LD23959.pep
MRDQFISLALILCVLHSACGLYFHISETERKCFIEEVPDETTVIVNYKVE
LYDPRSNGFMPSSPGIGMHVEVRDSDDKIVLSRVYSSQGRISFTSHTPGE
HVICMFSNSTAWFSGAQLRVHLDIQVGEHAIDYAHVAQKEKLTELQLRIR
QLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMGF
WQMRHLKSFFEAKKLV*

LD23959.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:58:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23165-PA 216 GF23165-PA 1..216 1..216 1140 96.8 Plus
Dana\GF23163-PA 130 GF23163-PA 4..130 43..174 280 46.2 Plus
Dana\GF16422-PA 206 GF16422-PA 6..205 10..216 221 28 Plus
Dana\GF19355-PA 208 GF19355-PA 35..208 31..216 181 26.9 Plus
Dana\GF19411-PA 226 GF19411-PA 34..217 17..214 157 24.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:58:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17343-PA 216 GG17343-PA 1..216 1..216 1150 98.1 Plus
Dere\GG14805-PA 351 GG14805-PA 1..198 1..198 570 52.5 Plus
Dere\GG11349-PA 206 GG11349-PA 5..205 9..216 227 29.1 Plus
Dere\GG18710-PA 208 GG18710-PA 20..208 16..216 173 26.6 Plus
Dere\GG18829-PA 210 GG18829-PA 8..201 5..214 151 22.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18190-PA 216 GH18190-PA 1..216 1..216 1114 94.4 Plus
Dgri\GH22337-PA 185 GH22337-PA 2..184 23..216 223 28.4 Plus
Dgri\GH24063-PA 209 GH24063-PA 25..209 20..216 173 28.2 Plus
Dgri\GH11947-PA 238 GH11947-PA 47..229 18..214 165 26.1 Plus
Dgri\GH20543-PA 203 GH20543-PA 4..203 5..216 139 22.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
eca-PA 216 CG33104-PA 1..216 1..216 1132 100 Plus
p24-2-PB 244 CG33105-PB 1..206 1..206 1058 97.6 Plus
p24-2-PA 244 CG33105-PA 1..206 1..206 1058 97.6 Plus
bai-PA 206 CG11785-PA 3..205 2..216 218 27.9 Plus
CHOp24-PB 208 CG3564-PB 16..208 10..216 181 25.6 Plus
CHOp24-PA 208 CG3564-PA 16..208 10..216 181 25.6 Plus
p24-1-PB 210 CG1967-PB 1..201 1..214 159 24.1 Plus
p24-1-PA 210 CG1967-PA 1..201 1..214 159 24.1 Plus
CG9308-PA 203 CG9308-PA 4..203 7..216 149 23.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10144-PA 216 GI10144-PA 1..216 1..216 1127 95.4 Plus
Dmoj\GI23975-PA 206 GI23975-PA 2..205 1..216 221 27.1 Plus
Dmoj\GI15674-PA 206 GI15674-PA 1..205 1..216 214 29.2 Plus
Dmoj\GI15191-PA 208 GI15191-PA 35..208 31..216 178 29.3 Plus
Dmoj\GI15363-PA 235 GI15363-PA 30..226 6..214 164 25.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:59:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12279-PA 216 GL12279-PA 1..216 1..216 1140 97.2 Plus
Dper\GL12278-PA 291 GL12278-PA 8..208 8..208 917 83.1 Plus
Dper\GL21889-PA 206 GL21889-PA 23..205 23..216 210 27.3 Plus
Dper\GL19967-PA 208 GL19967-PA 24..208 20..216 176 27.1 Plus
Dper\GL20350-PA 221 GL20350-PA 35..212 23..214 149 24.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:59:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17284-PA 216 GA17284-PA 1..216 1..216 1137 96.8 Plus
Dpse\GA26252-PB 291 GA26252-PB 8..208 8..208 937 85.1 Plus
Dpse\GA28584-PA 208 GA28584-PA 24..208 20..216 175 24.9 Plus
Dpse\GA15160-PA 221 GA15160-PA 35..212 23..214 148 24.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26230-PA 216 GM26230-PA 1..216 1..216 1155 99.1 Plus
Dsec\GM15094-PA 353 GM15094-PA 1..207 1..206 542 46.4 Plus
Dsec\GM12348-PA 208 GM12348-PA 35..208 31..216 173 28.2 Plus
Dsec\GM15877-PA 203 GM15877-PA 4..203 7..216 149 24.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:59:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20772-PA 216 GD20772-PA 1..216 1..216 1157 99.5 Plus
Dsim\GD20000-PA 352 GD20000-PA 16..206 16..206 553 49.7 Plus
Dsim\GD21160-PA 206 GD21160-PA 5..205 9..216 222 28.6 Plus
Dsim\GD16693-PA 208 GD16693-PA 35..208 31..216 173 28.2 Plus
Dsim\GD15445-PA 203 GD15445-PA 4..203 7..216 156 25.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:59:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23362-PA 216 GJ23362-PA 1..216 1..216 1129 95.4 Plus
Dvir\GJ23361-PA 474 GJ23361-PA 1..204 1..204 858 76 Plus
Dvir\GJ14134-PA 206 GJ14134-PA 23..205 23..216 217 27.8 Plus
Dvir\GJ14798-PA 208 GJ14798-PA 35..208 31..216 172 28.2 Plus
Dvir\GJ16789-PA 246 GJ16789-PA 55..237 18..214 156 25.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12749-PA 216 GK12749-PA 1..216 1..216 1122 94.9 Plus
Dwil\GK14360-PA 206 GK14360-PA 2..205 1..216 226 26.9 Plus
Dwil\GK14515-PA 299 GK14515-PA 126..299 31..216 178 27.4 Plus
Dwil\GK10123-PA 224 GK10123-PA 24..215 7..214 152 24.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24749-PA 216 GE24749-PA 1..216 1..216 1152 98.6 Plus
Dyak\GE25008-PA 351 GE25008-PA 1..203 1..205 558 49.8 Plus
Dyak\GE23545-PA 206 GE23545-PA 5..205 9..216 227 29.1 Plus
Dyak\GE16348-PA 208 GE16348-PA 11..208 5..216 183 27.1 Plus
Dyak\GE17592-PA 210 GE17592-PA 8..201 5..214 155 23.2 Plus

LD23959.hyp Sequence

Translation from 57 to 707

> LD23959.hyp
MRDQFISLALILCVLHSACGLYFHISETERKCFIEEVPDETTVIVNYKVE
LYDPRSNGFMPSSPGIGMHVEVRDSDDKIVLSRVYSSQGRISFTSHTPGE
HVICMFSNSTAWFSGAQLRVHLDIQVGEHAIDYAHVAQKEKLTELQLRIR
QLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMGF
WQMRHLKSFFEAKKLV*

LD23959.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:04:32
Subject Length Description Subject Range Query Range Score Percent Strand
eca-PA 216 CG33104-PA 1..216 1..216 1132 100 Plus
p24-2-PB 244 CG33105-PB 1..206 1..206 1058 97.6 Plus
p24-2-PA 244 CG33105-PA 1..206 1..206 1058 97.6 Plus
bai-PA 206 CG11785-PA 3..205 2..216 218 27.9 Plus
CHOp24-PB 208 CG3564-PB 16..208 10..216 181 25.6 Plus