Clone LD23983 Report

Search the DGRC for LD23983

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:239
Well:83
Vector:pOT2
Associated Gene/Transcriptdhd-RA
Protein status:LD23983.pep: gold
Preliminary Size:1300
Sequenced Size:772

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4193 2001-01-01 Release 2 assignment
CG4193 2002-05-16 Blastp of sequenced clone
CG4193 2003-01-01 Sim4 clustering to Release 3
dhd 2008-04-29 Release 5.5 accounting
dhd 2008-08-15 Release 5.9 accounting
dhd 2008-12-18 5.12 accounting

Clone Sequence Records

LD23983.complete Sequence

772 bp (772 high quality bases) assembled on 2002-05-16

GenBank Submission: AY118929

> LD23983.complete
AGCGAAAGCGCCAACAGCCCCATCACGTCAAGTTCTTTAATTTAAAAAAA
AGAAGAAAAACACTTTGCTAATCCTCGCGACATAAAAATGGCATCCGTAC
GCACCATGAACGACTATCACAAGCGCATCGAGGCGGCCGACGACAAGCTA
ATCGTGCTGGATTTCTATGCGACATGGTGTGGTCCCTGCAAGGAAATGGA
GAGCACCGTCAAATCGCTGGCCAGAAAATACTCCAGCAAGGCGGTGGTGC
TCAAGATCGATGTGGACAAATTCGAGGAGCTGACGGAGCGCTACAAGGTG
CGCAGCATGCCAACGTTTGTCTTTTTGCGCCAAAATCGACGCTTGGCCTC
CTTTGCCGGCGCCGACGAGCACAAGCTGACCAACATGATGGCCAAGCTGG
TGAAGGCGTAAGCAGCAATCCTGCCCAGCAATTAGCAATCAGCAGCGCAT
CTTTTTTTTTTTACTTATTTAACTCATCTTTTAAACATGTTCGCCTCATT
TGTGTTCGTTTATGTATTCGATGTTATGTGTATGCTCATGTGATGTTTAG
CTTGTAAGCGCGAGATGTGGGTAGCAGGAGATGCAGTGCAGCCAACAGCA
GTGACCAGATGATATATGCTATGCTACTACTACTACTTATATGCTATGAT
TTGTGGCGCGGAGGCGTGTCTGCGACACATAATCCCGCCCATTTAGCTTT
AAGATTCAGGCACTAAGAAGCAATTCGATCAATAAATTATTGTAACCACT
CTGAAAAAAAAAAAAAAAAAAA

LD23983.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:26
Subject Length Description Subject Range Query Range Score Percent Strand
dhd-RA 750 dhd-RA 1..750 1..750 3750 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:24:17
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 5204919..5205671 1..753 3655 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:14:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:24:15
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 5312373..5313125 1..753 3765 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 5320471..5321223 1..753 3765 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:24:16 has no hits.

LD23983.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:25:01 Download gff for LD23983.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 5204919..5205671 1..753 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:01:31 Download gff for LD23983.complete
Subject Subject Range Query Range Percent Splice Strand
dhd-RA 1..324 88..411 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:53:07 Download gff for LD23983.complete
Subject Subject Range Query Range Percent Splice Strand
dhd-RA 1..324 88..411 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:18:20 Download gff for LD23983.complete
Subject Subject Range Query Range Percent Splice Strand
dhd-RA 1..324 88..411 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:33 Download gff for LD23983.complete
Subject Subject Range Query Range Percent Splice Strand
dhd-RA 1..324 88..411 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:21:20 Download gff for LD23983.complete
Subject Subject Range Query Range Percent Splice Strand
dhd-RA 1..324 88..411 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:05:10 Download gff for LD23983.complete
Subject Subject Range Query Range Percent Splice Strand
dhd-RA 1..750 1..750 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:53:07 Download gff for LD23983.complete
Subject Subject Range Query Range Percent Splice Strand
dhd-RA 1..750 1..750 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:18:20 Download gff for LD23983.complete
Subject Subject Range Query Range Percent Splice Strand
dhd-RA 20..772 1..753 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:33 Download gff for LD23983.complete
Subject Subject Range Query Range Percent Splice Strand
dhd-RA 1..750 1..750 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:21:20 Download gff for LD23983.complete
Subject Subject Range Query Range Percent Splice Strand
dhd-RA 20..772 1..753 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:25:01 Download gff for LD23983.complete
Subject Subject Range Query Range Percent Splice Strand
X 5312373..5313125 1..753 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:25:01 Download gff for LD23983.complete
Subject Subject Range Query Range Percent Splice Strand
X 5312373..5313125 1..753 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:25:01 Download gff for LD23983.complete
Subject Subject Range Query Range Percent Splice Strand
X 5312373..5313125 1..753 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:18:20 Download gff for LD23983.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5206406..5207158 1..753 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:17:58 Download gff for LD23983.complete
Subject Subject Range Query Range Percent Splice Strand
X 5320471..5321223 1..753 100   Plus

LD23983.pep Sequence

Translation from 87 to 410

> LD23983.pep
MASVRTMNDYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSS
KAVVLKIDVDKFEELTERYKVRSMPTFVFLRQNRRLASFAGADEHKLTNM
MAKLVKA*

LD23983.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:48:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\TrxT-PA 177 GF20950-PA 5..106 4..105 268 47.1 Plus
Dana\Trx-2-PA 106 GF22780-PA 5..102 4..101 243 41.8 Plus
Dana\GF24615-PA 119 GF24615-PA 4..94 15..105 202 38.5 Plus
Dana\GF23991-PA 287 GF23991-PA 2..98 3..97 193 38.8 Plus
Dana\GF24914-PA 143 GF24914-PA 37..139 4..106 154 28.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:48:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\dhd-PA 107 GG18749-PA 1..107 1..107 531 92.5 Plus
Dere\TrxT-PA 149 GG18503-PA 5..104 4..103 277 47 Plus
Dere\Trx-2-PA 106 GG10043-PA 5..102 4..101 237 41.8 Plus
Dere\GG15284-PA 287 GG15284-PA 2..98 3..97 195 38.8 Plus
Dere\GG15694-PA 135 GG15694-PA 23..113 15..105 186 36.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:48:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\dhd-PA 106 GH24609-PA 1..106 1..106 412 67 Plus
Dgri\Trx-2-PA 106 GH10676-PA 4..106 3..105 261 40.8 Plus
Dgri\TrxT-PA 166 GH24365-PA 5..104 4..103 250 45 Plus
Dgri\GH14756-PA 133 GH14756-PA 16..117 3..104 216 34.3 Plus
Dgri\GH15527-PA 287 GH15527-PA 2..98 3..97 188 37.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:20
Subject Length Description Subject Range Query Range Score Percent Strand
dhd-PB 107 CG4193-PB 1..107 1..107 545 100 Plus
dhd-PA 107 CG4193-PA 1..107 1..107 545 100 Plus
TrxT-PB 157 CG3315-PB 5..104 4..103 251 46 Plus
TrxT-PA 157 CG3315-PA 5..104 4..103 251 46 Plus
Trx-2-PA 106 CG31884-PA 5..102 4..101 224 40.8 Plus
Trx-2-PB 106 CG31884-PB 5..102 4..101 224 40.8 Plus
CG13473-PA 139 CG13473-PA 23..113 15..105 193 37.4 Plus
Txl-PA 287 CG5495-PA 2..98 3..97 179 38.8 Plus
CG8993-PA 142 CG8993-PA 37..139 4..106 158 30.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:48:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\dhd-PA 106 GI11071-PA 1..104 1..104 377 60.6 Plus
Dmoj\GI14472-PA 106 GI14472-PA 1..106 1..106 361 56.6 Plus
Dmoj\GI14905-PA 106 GI14905-PA 1..106 1..106 297 50 Plus
Dmoj\Trx-2-PA 106 GI11084-PA 4..106 3..105 269 42.7 Plus
Dmoj\TrxT-PA 165 GI11058-PA 5..106 4..105 266 46.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:48:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\dhd-PA 106 GL14288-PA 1..106 1..106 386 62.3 Plus
Dper\GL14110-PA 106 GL14110-PA 1..106 1..106 364 59.4 Plus
Dper\TrxT-PA 167 GL14330-PA 5..108 4..107 271 45.2 Plus
Dper\GL24554-PA 141 GL24554-PA 11..112 4..105 215 34.3 Plus
Dper\GL16306-PA 287 GL16306-PA 2..98 3..97 186 36.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:48:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\dhd-PA 106 GA18018-PA 1..106 1..106 386 62.3 Plus
Dpse\TrxT-PA 167 GA17324-PA 5..108 4..107 271 44.2 Plus
Dpse\Trx-2-PA 106 GA16546-PA 4..102 3..101 246 41.4 Plus
Dpse\GA12311-PA 141 GA12311-PA 11..112 4..105 215 34.3 Plus
Dpse\GA26130-PA 86 GA26130-PA 3..74 20..91 213 51.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:48:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\dhd-PA 107 GM12398-PA 1..107 1..107 566 100 Plus
Dsec\TrxT-PA 172 GM12651-PA 5..104 4..103 252 44 Plus
Dsec\Trx-2-PA 106 GM17580-PA 5..102 4..101 241 41.8 Plus
Dsec\GM25478-PA 139 GM25478-PA 23..113 15..105 201 38.5 Plus
Dsec\GM14718-PA 287 GM14718-PA 2..98 3..97 191 37.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:49:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Trx-2-PA 106 GD23618-PA 5..102 4..101 241 41.8 Plus
Dsim\GD14500-PA 139 GD14500-PA 23..113 15..105 201 38.5 Plus
Dsim\GD11480-PA 145 GD11480-PA 34..120 4..91 139 27.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:49:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\dhd-PA 106 GJ16851-PA 1..106 1..106 420 67 Plus
Dvir\GJ16853-PA 108 GJ16853-PA 1..104 1..104 323 53.8 Plus
Dvir\Trx-2-PA 106 GJ18315-PA 4..106 3..105 267 40.8 Plus
Dvir\TrxT-PA 163 GJ16575-PA 5..106 4..105 257 44.1 Plus
Dvir\GJ13693-PA 162 GJ13693-PA 16..117 3..104 195 30.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:49:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\dhd3-PA 108 GK25752-PA 4..108 2..106 417 68.6 Plus
Dwil\dhd1-PA 108 GK25840-PA 5..108 3..106 416 70.2 Plus
Dwil\dhd2a-PA 108 GK18823-PA 5..108 3..106 403 69.2 Plus
Dwil\dhd2b-PA 108 GK10369-PA 5..108 3..106 403 69.2 Plus
Dwil\Trx-2-PA 106 GK23868-PA 4..104 3..103 254 43.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:49:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\dhd-PA 107 GE16391-PA 1..107 1..107 531 92.5 Plus
Dyak\TrxT-PA 157 GE16820-PA 5..104 4..103 249 46 Plus
Dyak\GE22025-PA 132 GE22025-PA 11..113 4..105 199 36.9 Plus
Dyak\Trx-2-PA 106 GE18857-PA 10..102 9..101 196 43 Plus
Dyak\GE21506-PA 287 GE21506-PA 2..98 3..97 193 38.8 Plus

LD23983.hyp Sequence

Translation from 173 to 556

> LD23983.hyp
MVWSLQGNGEHRQIAGQKILQQGGGAQDRCGQIRGADGALQGAQHANVCL
FAPKSTLGLLCRRRRAQADQHDGQAGEGVSSNPAQQLAISSASFFFYLFN
SSFKHVRLICVRLCIRCYVYAHVMFSL*
Sequence LD23983.hyp has no blast hits.