Clone LD24048 Report

Search the DGRC for LD24048

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:240
Well:48
Vector:pOT2
Associated Gene/TranscriptU2af38-RA
Protein status:LD24048.pep: gold
Preliminary Size:4600
Sequenced Size:1254

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3582 2001-01-01 Release 2 assignment
CG3582 2001-09-19 Blastp of sequenced clone
CG3582 2003-01-01 Sim4 clustering to Release 3
U2af38 2008-04-29 Release 5.5 accounting
U2af38 2008-08-15 Release 5.9 accounting
U2af38 2008-12-18 5.12 accounting

Clone Sequence Records

LD24048.complete Sequence

1254 bp (1254 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058537

> LD24048.complete
GCCGTGCAAAATACGACCAGACGCTGCTTTTTTCGGTTTCCGAAAATAAT
TGAAAATTATCACTAAATAAACAGGCGGCTAACATAATTGCAGTTTGACC
GCGTTGCAGAGACAAGCGGGTAGATAAGTTACACATTTTGGCCACAGCAA
CACCACAGTAAAGCCGCCAGCATGGCCGAGTACTTGGCATCCATTTTTGG
CACGGAAAAGGACAAGGTGAACTGTTCGTTCTACTTCAAGATCGGCGCCT
GCCGCCACGGCGACCGGTGCTCTCGCATCCACAACAAACCCACTTTCTCG
CAGACGGTGCTTCTCCAAAATCTATACGTGAACCCCCAAAACTCCGCCAA
ATCCGCGGATGGCTCCCATCTGGTGGCCAACGTCTCCGACGAGGAGATGC
AAGAACACTACGACAATTTTTTCGAGGACGTGTTCGTAGAGTGCGAGGAC
AAGTACGGGGAAATCGAGGAGATGAACGTGTGCGACAACCTAGGCGACCA
TCTGGTCGGCAATGTGTACATCAAATTCCGTAACGAGGCTGATGCGGAAA
AGGCGGCAAACGATTTGAACAACCGGTGGTTCGGTGGTCGACCGGTGTAC
TCGGAACTATCGCCGGTGACCGACTTCCGCGAGGCTTGCTGTCGGCAGTA
CGAGATGGGCGAATGTACCCGCTCCGGCTTCTGCAACTTCATGCACTTGA
AGCCCATCTCGCGTGAGCTGCGAAGGTACCTCTACTCCCGCCGCCGTCGT
GCCCGCTCCCGTTCCCGATCCCCTGGACGCCGTCGCGGCTCCCGCAGCAG
GTCCCGATCCCCGGGTCGAAGAGGAGGCGGCAGAGGCGACGGTGTCGGCG
GAGGAAACTACTTGAACAACGAGCGGGACAACATGCGTGGCAATGATCGC
GGAAACGATCGCGATCGCCGCAAAGGTGGTGGCGGAGGAGGCGGTGGTGG
TGGTGGACGGTATTAAATATTCTGGACATTTTTTCTGTACGGTGGCAATT
GAGAGAGAAAGCAACGGACAAGCAGTAACGCAAAGCATCGTGTATTTTAG
TCTCTGCGTTGGTTTTCCACGTTTTTATATCACTTTTGAGTAAACGAGAT
GGAAGGAGGAGGAGGAAAATGACGATGGGGAGTTCCACCACCTATGTACA
AACCCCCCGCGAAATATTTTACCGAGCGCCCATTAGAATTGTAATTTACT
ATACATACATTCATAATAATAAAATTGAGTAATATAAAAAAAAAAAAAAA
AAAA

LD24048.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:20:12
Subject Length Description Subject Range Query Range Score Percent Strand
U2af38-RA 1379 U2af38-RA 28..1262 1..1235 6175 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 293389..294411 1235..216 4990 99.4 Minus
chr2L 23010047 chr2L 294479..294694 216..1 1080 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:14:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 293353..294372 1235..216 5100 100 Minus
2L 23513712 2L 294440..294655 216..1 1080 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:43:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 293353..294372 1235..216 5100 100 Minus
2L 23513712 2L 294440..294655 216..1 1080 100 Minus
Blast to na_te.dros performed 2019-03-16 10:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 4569..4606 687..650 118 78.9 Minus

LD24048.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:41:03 Download gff for LD24048.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 293389..294411 216..1235 99 <- Minus
chr2L 294480..294694 1..215 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:01:36 Download gff for LD24048.complete
Subject Subject Range Query Range Percent Splice Strand
U2af38-RA 1..795 172..966 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:03:34 Download gff for LD24048.complete
Subject Subject Range Query Range Percent Splice Strand
U2af38-RA 1..795 172..966 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:01:16 Download gff for LD24048.complete
Subject Subject Range Query Range Percent Splice Strand
U2af38-RA 1..795 172..966 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:34:10 Download gff for LD24048.complete
Subject Subject Range Query Range Percent Splice Strand
U2af38-RA 1..795 172..966 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:13:38 Download gff for LD24048.complete
Subject Subject Range Query Range Percent Splice Strand
U2af38-RA 1..795 172..966 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:52:14 Download gff for LD24048.complete
Subject Subject Range Query Range Percent Splice Strand
U2af38-RA 25..1259 1..1235 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:03:34 Download gff for LD24048.complete
Subject Subject Range Query Range Percent Splice Strand
U2af38-RA 25..1259 1..1235 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:01:16 Download gff for LD24048.complete
Subject Subject Range Query Range Percent Splice Strand
U2af38-RA 27..1261 1..1235 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:34:11 Download gff for LD24048.complete
Subject Subject Range Query Range Percent Splice Strand
U2af38-RA 25..1259 1..1235 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:13:38 Download gff for LD24048.complete
Subject Subject Range Query Range Percent Splice Strand
U2af38-RA 27..1261 1..1235 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:41:03 Download gff for LD24048.complete
Subject Subject Range Query Range Percent Splice Strand
2L 293353..294372 216..1235 100 <- Minus
2L 294441..294655 1..215 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:41:03 Download gff for LD24048.complete
Subject Subject Range Query Range Percent Splice Strand
2L 293353..294372 216..1235 100 <- Minus
2L 294441..294655 1..215 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:41:03 Download gff for LD24048.complete
Subject Subject Range Query Range Percent Splice Strand
2L 293353..294372 216..1235 100 <- Minus
2L 294441..294655 1..215 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:01:16 Download gff for LD24048.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 293353..294372 216..1235 100 <- Minus
arm_2L 294441..294655 1..215 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:11:01 Download gff for LD24048.complete
Subject Subject Range Query Range Percent Splice Strand
2L 293353..294372 216..1235 100 <- Minus
2L 294441..294655 1..215 100   Minus

LD24048.pep Sequence

Translation from 171 to 965

> LD24048.pep
MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRIHNKPTFSQTVLLQN
LYVNPQNSAKSADGSHLVANVSDEEMQEHYDNFFEDVFVECEDKYGEIEE
MNVCDNLGDHLVGNVYIKFRNEADAEKAANDLNNRWFGGRPVYSELSPVT
DFREACCRQYEMGECTRSGFCNFMHLKPISRELRRYLYSRRRRARSRSRS
PGRRRGSRSRSRSPGRRGGGRGDGVGGGNYLNNERDNMRGNDRGNDRDRR
KGGGGGGGGGGGRY*

LD24048.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:27:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24893-PA 267 GF24893-PA 1..254 1..262 1246 93.9 Plus
Dana\GF21431-PA 314 GF21431-PA 156..312 4..157 167 26.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:27:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24659-PA 266 GG24659-PA 1..262 1..262 1372 100 Plus
Dere\GG25018-PA 447 GG25018-PA 157..312 5..157 178 26.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:27:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10217-PA 273 GH10217-PA 1..182 1..182 993 100 Plus
Dgri\GH11518-PA 312 GH11518-PA 155..310 5..157 173 28.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:40
Subject Length Description Subject Range Query Range Score Percent Strand
U2af38-PB 264 CG3582-PB 1..264 1..264 1439 100 Plus
U2af38-PA 264 CG3582-PA 1..264 1..264 1439 100 Plus
CG3294-PA 456 CG3294-PA 156..428 4..256 207 22.3 Plus
CG3294-PB 314 CG3294-PB 156..312 4..157 182 24.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:27:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15018-PA 274 GI15018-PA 1..182 1..182 991 100 Plus
Dmoj\GI17015-PA 170 GI17015-PA 26..168 18..157 172 26 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:27:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25824-PA 309 GL25824-PA 1..261 1..259 1003 87.8 Plus
Dper\GL14474-PA 448 GL14474-PA 154..330 3..176 193 27.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17536-PA 289 GA17536-PA 1..256 1..259 997 87.6 Plus
Dpse\GA17206-PA 448 GA17206-PA 154..330 3..176 198 24.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16679-PA 263 GM16679-PA 1..263 1..264 1367 99.6 Plus
Dsec\GM18489-PA 447 GM18489-PA 156..312 4..157 180 24.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22967-PA 263 GD22967-PA 1..263 1..264 1367 99.6 Plus
Dsim\GD23299-PA 492 GD23299-PA 156..331 4..176 191 24.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17240-PA 267 GJ17240-PA 1..182 1..182 994 100 Plus
Dvir\GJ24411-PA 449 GJ24411-PA 157..331 5..176 196 27.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:27:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14823-PA 287 GK14823-PA 1..182 1..182 993 100 Plus
Dwil\GK23757-PA 589 GK23757-PA 160..317 5..176 184 26 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:27:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16227-PA 267 GE16227-PA 1..262 1..262 1372 100 Plus
Dyak\GE18306-PA 496 GE18306-PA 156..312 4..157 179 24.1 Plus

LD24048.hyp Sequence

Translation from 171 to 965

> LD24048.hyp
MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRIHNKPTFSQTVLLQN
LYVNPQNSAKSADGSHLVANVSDEEMQEHYDNFFEDVFVECEDKYGEIEE
MNVCDNLGDHLVGNVYIKFRNEADAEKAANDLNNRWFGGRPVYSELSPVT
DFREACCRQYEMGECTRSGFCNFMHLKPISRELRRYLYSRRRRARSRSRS
PGRRRGSRSRSRSPGRRGGGRGDGVGGGNYLNNERDNMRGNDRGNDRDRR
KGGGGGGGGGGGRY*

LD24048.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
U2af38-PB 264 CG3582-PB 1..264 1..264 1439 100 Plus
U2af38-PA 264 CG3582-PA 1..264 1..264 1439 100 Plus
CG3294-PA 456 CG3294-PA 156..428 4..256 207 22.3 Plus
CG3294-PB 314 CG3294-PB 156..312 4..157 182 24.1 Plus