Clone LD24077 Report

Search the DGRC for LD24077

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:240
Well:77
Vector:pOT2
Associated Gene/TranscriptRpS2-RA
Protein status:LD24077.pep: gold
Preliminary Size:3700
Sequenced Size:915

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5920 2001-01-01 Release 2 assignment
CG5920 2002-03-29 Blastp of sequenced clone
CG5920 2003-01-01 Sim4 clustering to Release 3
sop 2008-04-29 Release 5.5 accounting
sop 2008-08-15 Release 5.9 accounting
sop 2008-12-18 5.12 accounting

Clone Sequence Records

LD24077.complete Sequence

915 bp (915 high quality bases) assembled on 2002-03-29

GenBank Submission: AY094799

> LD24077.complete
TCACCCCAATAAAGTTGATAGACCTACAAAATGGCGGACGAAGCTCCAGC
CCGTAGTGGATTCCGTGGCGGATTTGGCTCTCGTGGTGGTCGTGGTGGAC
GCGGTCGTGGCCGTGGACGCTGGGCCCGTGGACGTGGAAAGGAGGACTCC
AAGGAGTGGGTGCCAGTGACCAAGCTGGGACGCCTGGTGCGCGAGGGCAA
GATCAAGTCTTTGGAGGAGATCTACCTGTACTCGCTTCCCATCAAAGAGT
TCGAGATCATCGACTTCTTCCTGGGATCCTCGCTGAAGGATGAGGTGCTG
AAGATCATGCCCGTCCAGAAGCAGACCCGTGCTGGTCAGCGTACCCGTTT
CAAGGCCTTCGTTGCCATCGGCGACAACAATGGCCACATTGGTCTGGGCG
TTAAGTGCAGCAAGGAAGTGGCCACCGCCATCCGTGGTGCCATCATTCTG
GCCAAGCTCTCCGTGGTGCCCGTGCGCCGTGGCTACTGGGGCAACAAGAT
CGGCAAGCCCCACACCGTGCCCTGCAAGGTCACCGGCAAGTGCGGTTCCG
TCTCCGTGCGCCTCATCCCCGCTCCCCGTGGTACTGGCATTGTCTCGGCC
CCCGTGCCCAAGAAGCTGCTGACCATGGCCGGTATTGAGGATTGCTACAC
CTCGGCCCGTGGCTCCACTGGAACCCTCGGCAACTTCGCCAAGGCTACAT
ATGCCGCCATCGCCAAGACGTACGCGTACTTGACCCCCGATCTGTGGAAG
GAGATGCCTCTGGGCTCCACTCCTTACCAGGCATACTCGGACTTCCTGTC
CAAGCCCACTCCTCGTCTGCACGCCGATGCCTAAGTGAACACTTTCGAGG
CCAATCAATCCAGAGTTTTTGAATAAAGTCATAAACTTTTAAATGTAAAA
AAAAAAAAAAAAAAA

LD24077.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:57
Subject Length Description Subject Range Query Range Score Percent Strand
sop-RA 1458 sop-RA 325..1222 1..898 4490 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:35:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9895191..9896057 896..30 4335 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:14:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:35:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9896263..9897131 898..30 4345 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9896263..9897131 898..30 4345 100 Minus
2L 23513712 2L 9897473..9897501 29..1 145 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:35:20 has no hits.

LD24077.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:36:05 Download gff for LD24077.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9895191..9896057 30..896 100 <- Minus
chr2L 9896397..9896425 1..29 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:01:39 Download gff for LD24077.complete
Subject Subject Range Query Range Percent Splice Strand
sop-RA 1..804 31..834 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:53:53 Download gff for LD24077.complete
Subject Subject Range Query Range Percent Splice Strand
sop-RA 1..804 31..834 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:19:00 Download gff for LD24077.complete
Subject Subject Range Query Range Percent Splice Strand
RpS2-RA 1..804 31..834 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:36:21 Download gff for LD24077.complete
Subject Subject Range Query Range Percent Splice Strand
sop-RA 1..804 31..834 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:34:44 Download gff for LD24077.complete
Subject Subject Range Query Range Percent Splice Strand
RpS2-RA 1..804 31..834 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:06:23 Download gff for LD24077.complete
Subject Subject Range Query Range Percent Splice Strand
sop-RA 42..937 1..896 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:53:53 Download gff for LD24077.complete
Subject Subject Range Query Range Percent Splice Strand
sop-RA 42..937 1..896 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:19:00 Download gff for LD24077.complete
Subject Subject Range Query Range Percent Splice Strand
RpS2-RA 21..916 1..896 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-04 17:07:07 Download gff for LD24077.complete
Subject Subject Range Query Range Percent Splice Strand
sop-RA 42..937 1..896 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:34:44 Download gff for LD24077.complete
Subject Subject Range Query Range Percent Splice Strand
RpS2-RA 21..916 1..896 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:36:05 Download gff for LD24077.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9897473..9897501 1..29 100   Minus
2L 9896265..9897131 30..896 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:36:05 Download gff for LD24077.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9897473..9897501 1..29 100   Minus
2L 9896265..9897131 30..896 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:36:05 Download gff for LD24077.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9897473..9897501 1..29 100   Minus
2L 9896265..9897131 30..896 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:19:00 Download gff for LD24077.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9896265..9897131 30..896 100 <- Minus
arm_2L 9897473..9897501 1..29 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:19:00 Download gff for LD24077.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9896265..9897131 30..896 100 <- Minus
2L 9897473..9897501 1..29 100   Minus

LD24077.hyp Sequence

Translation from 30 to 833

> LD24077.hyp
MADEAPARSGFRGGFGSRGGRGGRGRGRGRWARGRGKEDSKEWVPVTKLG
RLVREGKIKSLEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMPVQKQTR
AGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRR
GYWGNKIGKPHTVPCKVTGKCGSVSVRLIPAPRGTGIVSAPVPKKLLTMA
GIEDCYTSARGSTGTLGNFAKATYAAIAKTYAYLTPDLWKEMPLGSTPYQ
AYSDFLSKPTPRLHADA*

LD24077.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:33:20
Subject Length Description Subject Range Query Range Score Percent Strand
RpS2-PC 267 CG5920-PC 1..267 1..267 1396 100 Plus
RpS2-PB 267 CG5920-PB 1..267 1..267 1396 100 Plus
RpS2-PA 267 CG5920-PA 1..267 1..267 1396 100 Plus

LD24077.pep Sequence

Translation from 30 to 833

> LD24077.pep
MADEAPARSGFRGGFGSRGGRGGRGRGRGRWARGRGKEDSKEWVPVTKLG
RLVREGKIKSLEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMPVQKQTR
AGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRR
GYWGNKIGKPHTVPCKVTGKCGSVSVRLIPAPRGTGIVSAPVPKKLLTMA
GIEDCYTSARGSTGTLGNFAKATYAAIAKTYAYLTPDLWKEMPLGSTPYQ
AYSDFLSKPTPRLHADA*

LD24077.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15233-PA 268 GF15233-PA 1..268 1..267 1354 98.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24001-PA 267 GG24001-PA 1..267 1..267 1373 98.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10440-PA 268 GH10440-PA 1..268 1..267 1348 97.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
RpS2-PC 267 CG5920-PC 1..267 1..267 1396 100 Plus
RpS2-PB 267 CG5920-PB 1..267 1..267 1396 100 Plus
RpS2-PA 267 CG5920-PA 1..267 1..267 1396 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24366-PA 268 GI24366-PA 1..268 1..267 1353 98.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:59:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19203-PA 268 GL19203-PA 1..268 1..267 1345 97.4 Plus
Dper\GL18987-PA 387 GL18987-PA 38..249 37..250 1043 92.5 Plus
Dper\GL13216-PA 217 GL13216-PA 33..216 37..267 882 77.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:59:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19229-PA 268 GA19229-PA 1..268 1..267 1345 97.4 Plus
Dpse\GA22914-PA 268 GA22914-PA 38..268 37..267 1181 97.4 Plus
Dpse\GA22913-PA 292 GA22913-PA 38..261 37..260 1086 93.3 Plus
Dpse\GA22532-PA 217 GA22532-PA 33..216 37..267 869 76.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:59:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12203-PA 267 GM12203-PA 1..267 1..267 1366 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:59:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22330-PA 267 GD22330-PA 1..267 1..267 1366 98.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:59:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21626-PA 268 GJ21626-PA 1..268 1..267 1350 97.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:59:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18106-PA 268 GK18106-PA 1..268 1..267 1340 97 Plus
Dwil\GK22287-PA 186 GK22287-PA 6..186 70..251 865 92.3 Plus
Dwil\GK21166-PA 213 GK21166-PA 39..205 38..226 769 82 Plus
Dwil\GK23130-PA 136 GK23130-PA 55..136 167..248 403 96.3 Plus
Dwil\GK23130-PA 136 GK23130-PA 2..55 42..95 264 92.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:59:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\sop-PA 267 GE10248-PA 1..267 1..267 1363 98.1 Plus