Clone LD24139 Report

Search the DGRC for LD24139

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:241
Well:39
Vector:pOT2
Associated Gene/TranscriptOsi14-RA
Protein status:LD24139.pep: gold
Preliminary Size:1072
Sequenced Size:1084

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1155 2001-01-01 Release 2 assignment
CG1155 2001-09-19 Blastp of sequenced clone
CG1155 2003-01-01 Sim4 clustering to Release 3
Osi14 2008-04-29 Release 5.5 accounting
Osi14 2008-08-15 Release 5.9 accounting
Osi14 2008-12-18 5.12 accounting

Clone Sequence Records

LD24139.complete Sequence

1084 bp (1084 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058538

> LD24139.complete
CTCAGAAAAGCAGCAGCCCGAAGCCCAGAATTGAAACCCCGGATCAGCTA
TATTAGCAAGGATTAACCGCGTCTAAATACCAATCGATCGAAAATGAAAG
TGTTTGCCATCGCTTGTGTGACCCTCTTGGCGGCCAGCTGCGTCTTTGCC
GCGCCCAGTGTTCAAGACAACCAGGTCGAGGGCGACAATACCCTGGGCCG
GGCCGCCCGGTATCTGGGCGCCTGTCTGGAGAGCGACGACATGGCCACCT
GCCTGGCCGTCAAGGGCATCACCGCACTCAACCGCGCCGCCAGGAGCAAC
AACATCGAGCTGGCCAGTGGAGTCACCTTCCAGAGGGATCCCGCCAGTCC
CGTTTCCCGCACGGGAAAATCGATGAGCGAGCAGGATGTCTATGCCGAGC
TGCCCCAGAATGCCGATGAGCGTACTGGTCGTCTAGTGGATCTGGCCGTC
TCTAGTGCCGCCGACTTCCTAAGCACCCACAACCTGGAGTTCAAGCTGCC
CGCCGAGACCACCCAGCAGGTGGCTCGTGCCCTCGATGAAGGCCGTGGCA
AGATCAAGAAGATGCTGGGACCCGTGGCTCTGGCCATTGGCGCCAAGCTG
TTCGCCGTCATTCCCCTGGTGCTCGGGTTTCTGGCCCTGCTGACCTTCAA
GGCCGTGATCGTGGCCAAGCTGGCCTTCTTCCTGGCCATTCTGGTCGGCG
GATCCCGCCTGCTGGGCGGATTCGGCAACAAGTTCGGAGGTAACTCCTTT
GCCGGAGCCTACAACTCGAACGCATGGTCCGCACCCGCCAGCGCCGGCTG
GAGCTCGGGAGCCTCCTCGTCCTATCCCTATGCCCGCAGCATCAGCGAGG
ATGGGTCCGATGCCCAGCAATTGGCCTACGCCGGCCAGCAGCAGCAGTAG
AAGCGGCTGGGAGACAGCTCAAACAGATGTGCCTTCGTTTTGAAACCTTT
AGCCTGTAGTAATTTATTCGAAATGTAATTAACTAATTTATTGACACACC
ACGCACACATCACCCGCAAGTCAAGTCGAATGTATGAATAAAACCAAGAG
TATTGCACCCGAAAAAAAAAAAAAAAAAAAAAAA

LD24139.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:20:13
Subject Length Description Subject Range Query Range Score Percent Strand
Osi14-RA 1472 Osi14-RA 142..1209 1..1068 5340 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:25:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2125892..2126413 540..1061 2610 100 Plus
chr3R 27901430 chr3R 2124833..2125168 1..336 1665 99.7 Plus
chr3R 27901430 chr3R 2125632..2125840 334..542 1045 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:14:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:25:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6300217..6300745 540..1068 2645 100 Plus
3R 32079331 3R 6299158..6299493 1..336 1680 100 Plus
3R 32079331 3R 6299957..6300165 334..542 1045 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:43:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6041048..6041576 540..1068 2645 100 Plus
3R 31820162 3R 6039989..6040324 1..336 1680 100 Plus
3R 31820162 3R 6040788..6040996 334..542 1045 100 Plus
Blast to na_te.dros performed 2019-03-15 18:25:22
Subject Length Description Subject Range Query Range Score Percent Strand
G5A 2841 G5A G5A 2841bp 60..116 436..380 123 68.4 Minus
R1-2 3216 R1-2 R1-2 3216bp 2717..2795 540..459 114 63.4 Minus

LD24139.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:26:03 Download gff for LD24139.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2124833..2125167 1..335 99 -> Plus
chr3R 2125634..2125839 336..541 100 -> Plus
chr3R 2125894..2126413 542..1061 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:01:44 Download gff for LD24139.complete
Subject Subject Range Query Range Percent Splice Strand
Osi14-RA 1..807 94..900 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:03:35 Download gff for LD24139.complete
Subject Subject Range Query Range Percent Splice Strand
Osi14-RA 1..807 94..900 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:03:12 Download gff for LD24139.complete
Subject Subject Range Query Range Percent Splice Strand
Osi14-RA 1..807 94..900 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:34:12 Download gff for LD24139.complete
Subject Subject Range Query Range Percent Splice Strand
Osi14-RA 1..807 94..900 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:02:28 Download gff for LD24139.complete
Subject Subject Range Query Range Percent Splice Strand
Osi14-RA 1..807 94..900 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:52:16 Download gff for LD24139.complete
Subject Subject Range Query Range Percent Splice Strand
Osi14-RA 27..1087 1..1061 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:03:35 Download gff for LD24139.complete
Subject Subject Range Query Range Percent Splice Strand
Osi14-RA 27..1087 1..1061 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:03:12 Download gff for LD24139.complete
Subject Subject Range Query Range Percent Splice Strand
Osi14-RA 31..1091 1..1061 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:34:12 Download gff for LD24139.complete
Subject Subject Range Query Range Percent Splice Strand
Osi14-RA 27..1087 1..1061 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:02:28 Download gff for LD24139.complete
Subject Subject Range Query Range Percent Splice Strand
Osi14-RA 31..1091 1..1061 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:26:03 Download gff for LD24139.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6299158..6299492 1..335 100 -> Plus
3R 6299959..6300164 336..541 100 -> Plus
3R 6300219..6300738 542..1061 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:26:03 Download gff for LD24139.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6299158..6299492 1..335 100 -> Plus
3R 6299959..6300164 336..541 100 -> Plus
3R 6300219..6300738 542..1061 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:26:03 Download gff for LD24139.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6299158..6299492 1..335 100 -> Plus
3R 6299959..6300164 336..541 100 -> Plus
3R 6300219..6300738 542..1061 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:03:12 Download gff for LD24139.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2125681..2125886 336..541 100 -> Plus
arm_3R 2124880..2125214 1..335 100 -> Plus
arm_3R 2125941..2126460 542..1061 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:11:03 Download gff for LD24139.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6039989..6040323 1..335 100 -> Plus
3R 6040790..6040995 336..541 100 -> Plus
3R 6041050..6041569 542..1061 100   Plus

LD24139.pep Sequence

Translation from 93 to 899

> LD24139.pep
MKVFAIACVTLLAASCVFAAPSVQDNQVEGDNTLGRAARYLGACLESDDM
ATCLAVKGITALNRAARSNNIELASGVTFQRDPASPVSRTGKSMSEQDVY
AELPQNADERTGRLVDLAVSSAADFLSTHNLEFKLPAETTQQVARALDEG
RGKIKKMLGPVALAIGAKLFAVIPLVLGFLALLTFKAVIVAKLAFFLAIL
VGGSRLLGGFGNKFGGNSFAGAYNSNAWSAPASAGWSSGASSSYPYARSI
SEDGSDAQQLAYAGQQQQ*

LD24139.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:47:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16386-PA 267 GF16386-PA 1..267 1..268 1159 89.2 Plus
Dana\GF16381-PA 232 GF16381-PA 40..232 50..267 223 29 Plus
Dana\GF16380-PA 273 GF16380-PA 69..224 48..207 182 31.1 Plus
Dana\GF16383-PA 295 GF16383-PA 9..215 2..207 181 30.1 Plus
Dana\GF18624-PA 305 GF18624-PA 39..278 34..253 174 27 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:47:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13215-PA 268 GG13215-PA 1..268 1..268 1373 98.1 Plus
Dere\GG13161-PA 233 GG13161-PA 22..233 31..267 246 30 Plus
Dere\GG13155-PA 274 GG13155-PA 71..221 48..202 192 32.1 Plus
Dere\GG13181-PA 295 GG13181-PA 65..216 53..207 183 31.6 Plus
Dere\GG10544-PA 302 GG10544-PA 23..275 19..253 163 24.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:47:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14030-PA 270 GH14030-PA 1..262 1..264 1040 83.8 Plus
Dgri\GH14025-PA 231 GH14025-PA 20..231 29..267 248 28.9 Plus
Dgri\GH14027-PA 306 GH14027-PA 66..217 53..207 177 30.3 Plus
Dgri\GH14024-PA 281 GH14024-PA 78..229 48..202 164 30.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
Osi14-PA 268 CG1155-PA 1..268 1..268 1336 100 Plus
Osi12-PA 295 CG1154-PA 11..269 3..268 286 28.5 Plus
Osi9-PA 233 CG15592-PA 1..233 3..267 270 29.5 Plus
Osi8-PA 274 CG15591-PA 71..274 48..250 215 29.7 Plus
Osi6-PB 312 CG1151-PB 27..306 1..254 206 29 Plus
Osi6-PA 312 CG1151-PA 27..306 1..254 206 29 Plus
Osi7-PA 288 CG1153-PA 8..284 4..266 181 26.1 Plus
Osi11-PA 302 CG15596-PA 12..275 11..253 157 25.4 Plus
Osi3-PB 288 CG1150-PB 51..282 44..266 156 28.8 Plus
Osi3-PA 288 CG1150-PA 51..282 44..266 156 28.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:47:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24403-PA 272 GI24403-PA 1..262 1..264 1138 85.7 Plus
Dmoj\GI24397-PA 232 GI24397-PA 25..232 34..267 242 28.7 Plus
Dmoj\GI24400-PA 289 GI24400-PA 65..218 53..209 184 29.9 Plus
Dmoj\GI24392-PA 282 GI24392-PA 8..276 10..266 163 26.1 Plus
Dmoj\GI24396-PA 285 GI24396-PA 78..233 48..202 160 33.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:47:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24067-PA 269 GL24067-PA 1..269 1..268 1121 88.1 Plus
Dper\GL24061-PA 232 GL24061-PA 40..232 50..267 227 28.5 Plus
Dper\GL24063-PA 307 GL24063-PA 68..220 53..207 183 31.6 Plus
Dper\GL24060-PA 291 GL24060-PA 79..238 48..202 161 32.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11061-PA 269 GA11061-PA 1..269 1..268 1123 88.5 Plus
Dpse\GA13834-PA 232 GA13834-PA 40..232 50..267 231 28.5 Plus
Dpse\GA11059-PA 310 GA11059-PA 71..223 53..207 184 31.6 Plus
Dpse\GA13833-PA 287 GA13833-PA 79..234 48..202 166 32.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10875-PA 268 GM10875-PA 1..268 1..268 1374 98.9 Plus
Dsec\GM10870-PA 233 GM10870-PA 22..233 31..267 246 30 Plus
Dsec\GM10872-PA 295 GM10872-PA 65..216 53..207 178 31 Plus
Dsec\GM10869-PA 274 GM10869-PA 71..221 48..202 177 31.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:47:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19857-PA 268 GD19857-PA 1..268 1..268 1383 99.3 Plus
Dsim\GD19850-PA 233 GD19850-PA 22..233 31..267 246 30 Plus
Dsim\GD19852-PA 295 GD19852-PA 65..216 53..207 178 31 Plus
Dsim\GD19553-PA 302 GD19553-PA 28..275 26..253 165 24.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:47:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14261-PA 277 GJ14261-PA 1..265 1..264 1117 84.6 Plus
Dvir\GJ14255-PA 231 GJ14255-PA 40..231 50..267 237 29 Plus
Dvir\GJ14258-PA 296 GJ14258-PA 30..210 22..207 191 31 Plus
Dvir\GJ14489-PA 321 GJ14489-PA 36..292 30..264 183 26.7 Plus
Dvir\GJ14248-PA 282 GJ14248-PA 8..276 10..266 167 27.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:47:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13044-PA 268 GK13044-PA 1..261 1..264 1146 86 Plus
Dwil\GK10390-PA 121 GK10390-PA 1..121 50..170 511 77.7 Plus
Dwil\GK13040-PA 601 GK13040-PA 40..187 50..210 179 26.7 Plus
Dwil\GK13041-PA 298 GK13041-PA 20..218 12..207 167 30.2 Plus
Dwil\GK21164-PA 231 GK21164-PA 76..227 48..198 160 32.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:47:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10198-PA 268 GE10198-PA 1..268 1..268 1369 97.8 Plus
Dyak\GE10192-PA 233 GE10192-PA 22..233 31..267 246 30 Plus
Dyak\GE10191-PA 274 GE10191-PA 71..221 48..202 183 31.4 Plus
Dyak\GE10195-PA 298 GE10195-PA 11..218 3..207 181 27.5 Plus
Dyak\GE24110-PA 302 GE24110-PA 25..275 21..253 157 24.4 Plus

LD24139.hyp Sequence

Translation from 93 to 899

> LD24139.hyp
MKVFAIACVTLLAASCVFAAPSVQDNQVEGDNTLGRAARYLGACLESDDM
ATCLAVKGITALNRAARSNNIELASGVTFQRDPASPVSRTGKSMSEQDVY
AELPQNADERTGRLVDLAVSSAADFLSTHNLEFKLPAETTQQVARALDEG
RGKIKKMLGPVALAIGAKLFAVIPLVLGFLALLTFKAVIVAKLAFFLAIL
VGGSRLLGGFGNKFGGNSFAGAYNSNAWSAPASAGWSSGASSSYPYARSI
SEDGSDAQQLAYAGQQQQ*

LD24139.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:07:34
Subject Length Description Subject Range Query Range Score Percent Strand
Osi14-PA 268 CG1155-PA 1..268 1..268 1336 100 Plus
Osi12-PA 295 CG1154-PA 11..269 3..268 286 28.5 Plus
Osi9-PA 233 CG15592-PA 1..233 3..267 270 29.5 Plus
Osi8-PA 274 CG15591-PA 71..274 48..250 215 29.7 Plus
Osi6-PB 312 CG1151-PB 27..306 1..254 206 29 Plus