Clone LD24159 Report

Search the DGRC for LD24159

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:241
Well:59
Vector:pOT2
Associated Gene/TranscriptProsbeta6-RA
Protein status:LD24159.pep: gold
Preliminary Size:4600
Sequenced Size:922

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4097 2001-01-01 Release 2 assignment
CG4097 2001-07-04 Blastp of sequenced clone
CG4097 2003-01-01 Sim4 clustering to Release 3
Pros26 2008-04-29 Release 5.5 accounting
Pros26 2008-08-15 Release 5.9 accounting
Pros26 2008-12-18 5.12 accounting

Clone Sequence Records

LD24159.complete Sequence

922 bp (922 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051697

> LD24159.complete
AAATCATTTCGTTGGTTTTTTACTTGGCGAGTTAATTGGTGAATTTCAGC
ACAAAACATGAGCAGATTGGGCTTTGAGCAATTCCCGGACTACCAGGTGC
CCGGCATGAAGCATCCTGATTTCTCGCCCTACGAGTCCAATGGCGGCTCC
ATTGTGGCCATCGCCGGAGATGACTTTGCCGTAATTGCAGCGGACACCCG
CCTGAGCAGCGGCTACAACATTCACTCGCGAACGCAGAGTAAACTCTTTA
AACTCTCGCCCCAGACAGTGTTGGGTTCCGCAGGCTGCTGGGCGGACACG
CTCTCGTTGACCGGATCGATTAAGGTGCGCATGCAGAGCTACGAGCATAC
CCATCTGCGCACCATGACCACTGAGGCCGTGGCCCAGATGCTCTCCATCG
CCATGTACAATCGCCGCTTCTTCCCGTACTACGTGTCGAACATTCTGGCT
GGAATTGACAACGAGGGCAAGGGCGTCGTCTACTCCTACGATCCCATCGG
TCACTGCGAGAAGGCTACATACCGCGCCGGCGGCACTGCCGGCACCCTGC
TGCAACCGGTGCTGGACAACCAGATTGGTCACAAGAACATGAATTTGGAA
GACGCCGACAAGATCAAGTTAACCAAGGAGCGGGCCGTGAGCGTTGCCTC
CGACACCTTCATCTCTGCCGCTGAGCGCGACATCTACACCGGCGACTCTG
TGCTGATCAACATCATAACCAAAGATGGAATTGAAGTACGAACTCTGACG
CTGCGTCAGGACTAGCCTGTGGCGAGGATGTTGCCGTTTCTTTTGGTTAG
GGGCATTCGGTGGAAACCAGGCATTCTAAGTTAGTTGGCTTCAAATTTTT
GTATTTACCCAAAACAACAAAACATCGTAATAAACCGAATCTTTGAGATT
TAAAAAAAAAAAAAAAAAAAAA

LD24159.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:32:48
Subject Length Description Subject Range Query Range Score Percent Strand
Pros26-RA 1161 Pros26-RA 216..1120 1..905 4525 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:35:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16599174..16599929 901..146 3780 100 Minus
chr3L 24539361 chr3L 16600004..16600149 146..1 730 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:14:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:35:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16609396..16610155 905..146 3800 100 Minus
3L 28110227 3L 16610230..16610375 146..1 730 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:54:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16602496..16603255 905..146 3800 100 Minus
3L 28103327 3L 16603330..16603475 146..1 730 100 Minus
Blast to na_te.dros performed on 2019-03-15 13:35:26 has no hits.

LD24159.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:36:33 Download gff for LD24159.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16599174..16599928 147..901 100 <- Minus
chr3L 16600004..16600149 1..146 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:01:45 Download gff for LD24159.complete
Subject Subject Range Query Range Percent Splice Strand
Pros26-RA 1..708 58..765 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:22:01 Download gff for LD24159.complete
Subject Subject Range Query Range Percent Splice Strand
Pros26-RA 1..708 58..765 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:05:37 Download gff for LD24159.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta6-RA 1..708 58..765 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:54:38 Download gff for LD24159.complete
Subject Subject Range Query Range Percent Splice Strand
Pros26-RA 1..708 58..765 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:34:29 Download gff for LD24159.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta6-RA 1..708 58..765 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:19:09 Download gff for LD24159.complete
Subject Subject Range Query Range Percent Splice Strand
Pros26-RA 47..947 1..901 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:22:01 Download gff for LD24159.complete
Subject Subject Range Query Range Percent Splice Strand
Pros26-RA 47..947 1..901 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:05:37 Download gff for LD24159.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta6-RA 44..944 1..901 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:54:38 Download gff for LD24159.complete
Subject Subject Range Query Range Percent Splice Strand
Pros26-RA 47..947 1..901 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:34:29 Download gff for LD24159.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta6-RA 44..944 1..901 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:36:33 Download gff for LD24159.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16609400..16610154 147..901 100 <- Minus
3L 16610230..16610375 1..146 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:36:33 Download gff for LD24159.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16609400..16610154 147..901 100 <- Minus
3L 16610230..16610375 1..146 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:36:33 Download gff for LD24159.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16609400..16610154 147..901 100 <- Minus
3L 16610230..16610375 1..146 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:05:37 Download gff for LD24159.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16602500..16603254 147..901 100 <- Minus
arm_3L 16603330..16603475 1..146 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:32:21 Download gff for LD24159.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16602500..16603254 147..901 100 <- Minus
3L 16603330..16603475 1..146 100   Minus

LD24159.hyp Sequence

Translation from 57 to 764

> LD24159.hyp
MSRLGFEQFPDYQVPGMKHPDFSPYESNGGSIVAIAGDDFAVIAADTRLS
SGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKVRMQSYEHTHL
RTMTTEAVAQMLSIAMYNRRFFPYYVSNILAGIDNEGKGVVYSYDPIGHC
EKATYRAGGTAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSVASDT
FISAAERDIYTGDSVLINIITKDGIEVRTLTLRQD*

LD24159.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:55:50
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta6-PA 235 CG4097-PA 1..235 1..235 1209 100 Plus
Prosbeta3-PA 205 CG11981-PA 7..205 28..235 197 28.9 Plus
Prosbeta1-PA 224 CG8392-PA 3..202 20..228 147 28 Plus

LD24159.pep Sequence

Translation from 57 to 764

> LD24159.pep
MSRLGFEQFPDYQVPGMKHPDFSPYESNGGSIVAIAGDDFAVIAADTRLS
SGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKVRMQSYEHTHL
RTMTTEAVAQMLSIAMYNRRFFPYYVSNILAGIDNEGKGVVYSYDPIGHC
EKATYRAGGTAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSVASDT
FISAAERDIYTGDSVLINIITKDGIEVRTLTLRQD*

LD24159.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:30:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10515-PA 235 GF10515-PA 1..235 1..235 1072 84.7 Plus
Dana\GF18436-PA 205 GF18436-PA 7..205 28..235 208 28.9 Plus
Dana\GF13326-PA 229 GF13326-PA 13..202 27..228 152 28.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:30:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15866-PA 235 GG15866-PA 1..235 1..235 1208 96.2 Plus
Dere\GG17403-PA 205 GG17403-PA 7..205 28..235 208 28.9 Plus
Dere\GG22308-PA 224 GG22308-PA 3..204 20..230 147 27.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:31:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16458-PA 235 GH16458-PA 1..235 1..235 1053 83 Plus
Dgri\GH24307-PA 285 GH24307-PA 82..285 30..233 402 42 Plus
Dgri\GH21877-PA 223 GH21877-PA 29..223 26..233 333 38 Plus
Dgri\GH17107-PA 254 GH17107-PA 60..254 26..233 329 37.5 Plus
Dgri\GH18224-PA 205 GH18224-PA 7..205 28..235 209 28.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta6-PA 235 CG4097-PA 1..235 1..235 1209 100 Plus
Prosbeta3-PA 205 CG11981-PA 7..205 28..235 197 28.9 Plus
Prosbeta1-PA 224 CG8392-PA 3..202 20..228 147 28 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:31:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16713-PA 235 GI16713-PA 1..235 1..235 1035 81.3 Plus
Dmoj\GI10178-PA 205 GI10178-PA 7..205 28..235 212 29.4 Plus
Dmoj\GI21700-PA 101 GI21700-PA 1..101 136..235 165 41.6 Plus
Dmoj\GI22558-PA 203 GI22558-PA 4..203 27..235 162 26.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:31:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17976-PA 235 GL17976-PA 1..235 1..235 1062 83.4 Plus
Dper\GL20944-PA 224 GL20944-PA 4..222 15..235 618 53.8 Plus
Dper\GL12496-PA 205 GL12496-PA 7..205 28..235 211 29.9 Plus
Dper\GL26359-PA 204 GL26359-PA 2..204 27..235 203 28.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:31:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17955-PA 235 GA17955-PA 1..235 1..235 1062 83.4 Plus
Dpse\GA28639-PA 216 GA28639-PA 10..214 25..235 590 54 Plus
Dpse\GA11308-PA 205 GA11308-PA 7..205 28..235 211 29.9 Plus
Dpse\GA28829-PA 204 GA28829-PA 2..204 27..235 201 28.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:31:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24382-PA 235 GM24382-PA 1..235 1..235 1243 97.9 Plus
Dsec\GM26292-PA 205 GM26292-PA 7..205 28..235 208 28.9 Plus
Dsec\GM20098-PA 224 GM20098-PA 2..204 19..230 143 27.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:31:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12455-PA 235 GD12455-PA 1..235 1..235 1243 97.9 Plus
Dsim\GD20828-PA 205 GD20828-PA 7..205 28..235 208 28.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:31:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12457-PA 235 GJ12457-PA 1..235 1..235 1040 81.3 Plus
Dvir\GJ15696-PA 256 GJ15696-PA 46..256 26..235 583 48.8 Plus
Dvir\GJ15881-PA 262 GJ15881-PA 52..262 26..235 583 48.8 Plus
Dvir\GJ10880-PA 205 GJ10880-PA 7..205 28..235 213 29.4 Plus
Dvir\GJ23747-PA 208 GJ23747-PA 10..208 28..235 179 27 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:31:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20318-PA 233 GK20318-PA 4..233 6..235 1006 80 Plus
Dwil\GK16137-PA 229 GK16137-PA 15..229 14..235 568 51.1 Plus
Dwil\GK20619-PA 229 GK20619-PA 21..228 22..232 441 42.5 Plus
Dwil\GK22295-PA 212 GK22295-PA 4..211 22..232 420 41 Plus
Dwil\GK20618-PA 173 GK20618-PA 2..172 58..232 323 38.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:31:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22205-PA 235 GE22205-PA 1..235 1..235 1241 98.3 Plus
Dyak\GE24806-PA 205 GE24806-PA 7..205 28..235 208 28.9 Plus
Dyak\GE14105-PA 224 GE14105-PA 3..204 20..230 144 27.7 Plus