Clone LD24242 Report

Search the DGRC for LD24242

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:242
Well:42
Vector:pOT2
Associated Gene/TranscriptBCAS2-RA
Protein status:LD24242.pep: gold
Preliminary Size:1300
Sequenced Size:981

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4980 2001-01-01 Release 2 assignment
CG4980 2002-05-31 Blastp of sequenced clone
CG4980 2003-01-01 Sim4 clustering to Release 3
CG4980 2008-04-29 Release 5.5 accounting
CG4980 2008-08-15 Release 5.9 accounting
CG4980 2008-12-18 5.12 accounting

Clone Sequence Records

LD24242.complete Sequence

981 bp (981 high quality bases) assembled on 2002-05-31

GenBank Submission: AY118331

> LD24242.complete
AAACAGTCTCAAAACACAGAAATTAATAATAAATAATGGCTGGCGAAGTT
ATTGTGGATGCTCTGCCCTACATAGATCACGGCTATGACGATGTGGGCGT
CCGGGAATCGGCTCTCGCCATGGTGGAGGAGGAATGCCGGCGCTATAGGC
CCACAAAAAATTACCTTGACCATCTGCCACTGCCCGCCAGCTCGCCCTTT
GAGACTCCGCTGATGGCCAACGAGTTCGAGCGCATCCAGAACCGCCTGCC
CATGGAGACGCTCTCCATGAAGCGCTACGAACTGCCACCGCCGCCATCGG
GCAAATTGTCGGAGGTGTCCGCCTGGCAGGAGGCCATTGAGAACTCGATG
GCCCAGCTGGAGCACCAGTGGGTGCGCTCTCTCAACCTGGAGCTAATGCT
CGACTACGGCACGGAGGCATGGAAGTCCTACCTGGAGGTCTTCACCGCCA
TGCAGGCGAAGGCGCAGCTCCAGCTGCAGCAGCTGAAGAAGGACATTCAA
GATGTCAACTGGCAGCGCAAGCAGGCGCAAACGCAGGCCGGCGAGCGACT
GCGCTCCCTGGAAGCCCATTGGGTGCTGCTGGTCTCCAAGAACTACGAGA
TCGAGACGGAGTGCGTCGAGCTGGAAAAGATCGTCCATGCCGCCCGTCAG
CAGCTGCGGAAGATTACCCCGCCGCCCAGCGCCAATGACACGGCTCCAAC
GCCGGAATACACGAATGGTTTCGACCAGAACGATTTGGCCGAGAGCAACG
GCAGTAGCTCCAGCAATCCAGATCCAAGCCAACCTGGCGATGATGGAACA
GATGCCGATGGTGACAGCAAGGAGGAGGACAAATCCGAGGCACAGGAGGA
ATCTTCCAATGGATCAACGTAGATTTAGTACACTGAGCGAAAGCATGAAG
CAAGTTAAAGAAAAACTTACGACTGTAACTAAATATAAAGGATATTAAAA
AAAACAGCTAAAAAAAAAAAAAAAAAAAAAA

LD24242.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:55:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG4980-RA 1070 CG4980-RA 77..1040 1..964 4820 100 Plus
CG4980.a 983 CG4980.a 162..978 148..964 4085 100 Plus
CG4980.a 983 CG4980.a 53..164 1..112 560 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23744244..23745093 959..110 4175 99.4 Minus
chr3R 27901430 chr3R 23745159..23745269 111..1 555 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:14:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27921278..27922132 964..110 4275 100 Minus
3R 32079331 3R 27922198..27922308 111..1 555 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:28:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 27662109..27662963 964..110 4275 100 Minus
3R 31820162 3R 27663029..27663139 111..1 555 100 Minus
Blast to na_te.dros performed on 2019-03-16 20:23:28 has no hits.

LD24242.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:24:13 Download gff for LD24242.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 23744244..23745092 111..959 99 <- Minus
chr3R 23745160..23745269 1..110 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:02:04 Download gff for LD24242.complete
Subject Subject Range Query Range Percent Splice Strand
CG4980-RA 1..837 36..872 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:34:08 Download gff for LD24242.complete
Subject Subject Range Query Range Percent Splice Strand
CG4980-RA 1..837 36..872 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:22:08 Download gff for LD24242.complete
Subject Subject Range Query Range Percent Splice Strand
BCAS2-RA 1..837 36..872 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:25:43 Download gff for LD24242.complete
Subject Subject Range Query Range Percent Splice Strand
CG4980-RA 1..837 36..872 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:01:53 Download gff for LD24242.complete
Subject Subject Range Query Range Percent Splice Strand
BCAS2-RA 1..837 36..872 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:05:15 Download gff for LD24242.complete
Subject Subject Range Query Range Percent Splice Strand
CG4980-RA 44..1002 1..959 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:34:08 Download gff for LD24242.complete
Subject Subject Range Query Range Percent Splice Strand
CG4980-RA 44..1002 1..959 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:22:08 Download gff for LD24242.complete
Subject Subject Range Query Range Percent Splice Strand
BCAS2-RA 49..1007 1..959 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:25:43 Download gff for LD24242.complete
Subject Subject Range Query Range Percent Splice Strand
CG4980-RA 44..1002 1..959 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:01:53 Download gff for LD24242.complete
Subject Subject Range Query Range Percent Splice Strand
BCAS2-RA 49..1007 1..959 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:24:13 Download gff for LD24242.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27922199..27922308 1..110 100   Minus
3R 27921283..27922131 111..959 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:24:13 Download gff for LD24242.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27922199..27922308 1..110 100   Minus
3R 27921283..27922131 111..959 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:24:13 Download gff for LD24242.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27922199..27922308 1..110 100   Minus
3R 27921283..27922131 111..959 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:22:08 Download gff for LD24242.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23747921..23748030 1..110 100   Minus
arm_3R 23747005..23747853 111..959 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:58:08 Download gff for LD24242.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27662114..27662962 111..959 100 <- Minus
3R 27663030..27663139 1..110 100   Minus

LD24242.pep Sequence

Translation from 35 to 871

> LD24242.pep
MAGEVIVDALPYIDHGYDDVGVRESALAMVEEECRRYRPTKNYLDHLPLP
ASSPFETPLMANEFERIQNRLPMETLSMKRYELPPPPSGKLSEVSAWQEA
IENSMAQLEHQWVRSLNLELMLDYGTEAWKSYLEVFTAMQAKAQLQLQQL
KKDIQDVNWQRKQAQTQAGERLRSLEAHWVLLVSKNYEIETECVELEKIV
HAARQQLRKITPPPSANDTAPTPEYTNGFDQNDLAESNGSSSSNPDPSQP
GDDGTDADGDSKEEDKSEAQEESSNGST*

LD24242.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:35:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16139-PA 273 GF16139-PA 1..272 1..277 1236 84.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:35:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12084-PA 276 GG12084-PA 1..276 1..278 1240 92.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:35:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19168-PA 290 GH19168-PA 1..241 1..243 1106 84.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:14
Subject Length Description Subject Range Query Range Score Percent Strand
BCAS2-PA 278 CG4980-PA 1..278 1..278 1452 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23273-PA 275 GI23273-PA 1..213 1..213 1012 93 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:35:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23883-PA 286 GL23883-PA 1..233 1..234 1043 88.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:35:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18571-PA 284 GA18571-PA 1..233 1..234 1043 88.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:35:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16313-PA 278 GM16313-PA 1..278 1..278 1292 96 Plus
Dsec\GM16249-PA 278 GM16249-PA 1..278 1..278 1292 96 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:35:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18049-PA 277 GD18049-PA 1..277 1..278 1243 94.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:35:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10773-PA 256 GJ10773-PA 1..249 1..253 1036 82.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:35:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11659-PA 294 GK11659-PA 1..294 1..277 1058 74 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:35:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10530-PA 276 GE10530-PA 1..276 1..278 1321 94.6 Plus

LD24242.hyp Sequence

Translation from 35 to 871

> LD24242.hyp
MAGEVIVDALPYIDHGYDDVGVRESALAMVEEECRRYRPTKNYLDHLPLP
ASSPFETPLMANEFERIQNRLPMETLSMKRYELPPPPSGKLSEVSAWQEA
IENSMAQLEHQWVRSLNLELMLDYGTEAWKSYLEVFTAMQAKAQLQLQQL
KKDIQDVNWQRKQAQTQAGERLRSLEAHWVLLVSKNYEIETECVELEKIV
HAARQQLRKITPPPSANDTAPTPEYTNGFDQNDLAESNGSSSSNPDPSQP
GDDGTDADGDSKEEDKSEAQEESSNGST*

LD24242.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
BCAS2-PA 278 CG4980-PA 1..278 1..278 1452 100 Plus