Clone LD24265 Report

Search the DGRC for LD24265

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:242
Well:65
Vector:pOT2
Associated Gene/TranscriptCG6543-RA
Protein status:LD24265.pep: gold
Preliminary Size:1244
Sequenced Size:1076

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6543 2003-01-01 Sim4 clustering to Release 3
CG6543 2003-01-14 Blastp of sequenced clone
CG6543 2008-04-29 Release 5.5 accounting
CG6543 2008-08-15 Release 5.9 accounting
CG6543 2008-12-18 5.12 accounting

Clone Sequence Records

LD24265.complete Sequence

1076 bp (1076 high quality bases) assembled on 2003-01-14

GenBank Submission: BT003259

> LD24265.complete
CCAGATACCGCCACAGATTAGATAACGAATTGCACTTGCAGCCGGCTCAG
AGTTCCTTCAATTGAAAATGGCCAACATTGCTAAGATCTTCGCTAGCCGC
GCCCAGTGCGTCCTGCAGGCAGCCGCCCGTCAGCCACAGGTGGCCACCCG
TTTCAGCAGCTCCTCCACCAACAACAACTGGGAGTACATCAAGACCGAAG
TGGCCGGCGAGGGCAAGAACGTAGGCGTGATCACCCTGAACCGCCCCAAG
GCCCTGAATGCCCTCTGCAATGGCCTGATGAAGGAGCTGTCCACCGCATT
GCAGCAATTCAGCAAGGATAAGACCATCTCCGCCATCGTTTTGACGGGCA
GCGAGAAGGCCTTCGCCGCTGGCGCTGATATTAAGGAGATGGTGGGCAAC
ACCTACTCGCAGTGCATCCAGGGCAACTTCTTGAACGACTGGACAGAGGT
GGCCCGCACCCAGAAGCCCATCATTGCTGCCGTGAATGGTTACGCCTTGG
GCGGTGGCTGTGAGCTGGCCATGATGTGCGACATCATATATGCCGGTGAC
AAGGCCAAGTTTGGTCAGCCTGAAATTGCCCTGGGCACCATTCCCGGTGC
CGGTGGCACCCAGCGTCTGACCCGCGTCGTTGGCAAGTCCAAGGCCATGG
AAATGTGCCTCACCGGCAATATGATCGGCGCCCAGGAGGCTGAGAAGCTG
GGTCTGGCCAGCAAGGTGGTGCCCGCCGACCAGTTATTGGGCGAGGCCGT
CAAGCTGGGCGAGAAGATCGGCACCCACTCCAATCTGATCGTGCAGCTGT
GCAAGGAGGCGGTTAACACGGCTTACGAGACCACTCTCCAAGAGGGCCTG
AAGTTCGAGCGTCGCACCTTCCATGCCACGTTCTCCACGGCCGATCGCAA
GGAGGGCATGACCGCTTTCGCCGAGAAGCGCCCTGCCAAGTTTACCAACG
AGTAAATACTACCCTAATCAATCCCAGCCAGCTTTGCATTTATATTATCT
AAAAGAAAAACTGTTGTTTCTACGCAATTAAAACTTTAATCGTGATAATT
TGAAAATGAAAAAAAAAAAAAAAAAA

LD24265.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:26:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG6543-RB 1153 CG6543-RB 96..1153 1..1058 5290 100 Plus
CG6543-RA 1114 CG6543-RA 98..1114 42..1058 5085 100 Plus
CG30485-RA 3110 CG30485-RA 3064..3110 1060..1014 235 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:35:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9740531..9741256 890..165 3585 99.6 Minus
chr2R 21145070 chr2R 9740298..9740467 1058..889 850 100 Minus
chr2R 21145070 chr2R 9741453..9741616 164..1 820 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:15:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:35:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13853180..13853905 890..165 3630 100 Minus
2R 25286936 2R 13852945..13853116 1060..889 860 100 Minus
2R 25286936 2R 13854102..13854265 164..1 820 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13854379..13855104 890..165 3630 100 Minus
2R 25260384 2R 13854144..13854315 1060..889 860 100 Minus
2R 25260384 2R 13855301..13855464 164..1 820 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:35:23 has no hits.

LD24265.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:36:06 Download gff for LD24265.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9740298..9740466 890..1058 100 <- Minus
chr2R 9740532..9741256 165..889 99 <- Minus
chr2R 9741453..9741616 1..164 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:02:08 Download gff for LD24265.complete
Subject Subject Range Query Range Percent Splice Strand
CG6543-RA 1..888 68..955 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:57:14 Download gff for LD24265.complete
Subject Subject Range Query Range Percent Splice Strand
CG6543-RA 1..888 68..955 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:19:02 Download gff for LD24265.complete
Subject Subject Range Query Range Percent Splice Strand
CG6543-RB 1..888 68..955 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:48:04 Download gff for LD24265.complete
Subject Subject Range Query Range Percent Splice Strand
CG6543-RA 1..888 68..955 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:34:47 Download gff for LD24265.complete
Subject Subject Range Query Range Percent Splice Strand
CG6543-RB 1..888 68..955 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:13:15 Download gff for LD24265.complete
Subject Subject Range Query Range Percent Splice Strand
CG6543-RB 36..1093 1..1058 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:57:14 Download gff for LD24265.complete
Subject Subject Range Query Range Percent Splice Strand
CG6543-RB 38..1095 1..1058 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:19:02 Download gff for LD24265.complete
Subject Subject Range Query Range Percent Splice Strand
CG6543-RB 67..1124 1..1058 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:48:04 Download gff for LD24265.complete
Subject Subject Range Query Range Percent Splice Strand
CG6543-RB 36..1093 1..1058 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:34:47 Download gff for LD24265.complete
Subject Subject Range Query Range Percent Splice Strand
CG6543-RB 67..1124 1..1058 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:36:06 Download gff for LD24265.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13852947..13853115 890..1058 100 <- Minus
2R 13853181..13853905 165..889 100 <- Minus
2R 13854102..13854265 1..164 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:36:06 Download gff for LD24265.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13852947..13853115 890..1058 100 <- Minus
2R 13853181..13853905 165..889 100 <- Minus
2R 13854102..13854265 1..164 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:36:06 Download gff for LD24265.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13852947..13853115 890..1058 100 <- Minus
2R 13853181..13853905 165..889 100 <- Minus
2R 13854102..13854265 1..164 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:19:02 Download gff for LD24265.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9740452..9740620 890..1058 100 <- Minus
arm_2R 9740686..9741410 165..889 100 <- Minus
arm_2R 9741607..9741770 1..164 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:19:27 Download gff for LD24265.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13854380..13855104 165..889 100 <- Minus
2R 13855301..13855464 1..164 100   Minus
2R 13854146..13854314 890..1058 100 <- Minus

LD24265.hyp Sequence

Translation from 67 to 954

> LD24265.hyp
MANIAKIFASRAQCVLQAAARQPQVATRFSSSSTNNNWEYIKTEVAGEGK
NVGVITLNRPKALNALCNGLMKELSTALQQFSKDKTISAIVLTGSEKAFA
AGADIKEMVGNTYSQCIQGNFLNDWTEVARTQKPIIAAVNGYALGGGCEL
AMMCDIIYAGDKAKFGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTG
NMIGAQEAEKLGLASKVVPADQLLGEAVKLGEKIGTHSNLIVQLCKEAVN
TAYETTLQEGLKFERRTFHATFSTADRKEGMTAFAEKRPAKFTNE*

LD24265.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:10:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG6543-PA 295 CG6543-PA 1..295 1..295 1497 100 Plus
CG6543-PB 295 CG6543-PB 1..295 1..295 1497 100 Plus
CG8778-PA 299 CG8778-PA 7..299 11..295 376 34.5 Plus
CG6984-PA 285 CG6984-PA 38..285 48..295 297 28.9 Plus
CG5844-PA 378 CG5844-PA 47..269 42..269 259 29.7 Plus

LD24265.pep Sequence

Translation from 67 to 954

> LD24265.pep
MANIAKIFASRAQCVLQAAARQPQVATRFSSSSTNNNWEYIKTEVAGEGK
NVGVITLNRPKALNALCNGLMKELSTALQQFSKDKTISAIVLTGSEKAFA
AGADIKEMVGNTYSQCIQGNFLNDWTEVARTQKPIIAAVNGYALGGGCEL
AMMCDIIYAGDKAKFGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTG
NMIGAQEAEKLGLASKVVPADQLLGEAVKLGEKIGTHSNLIVQLCKEAVN
TAYETTLQEGLKFERRTFHATFSTADRKEGMTAFAEKRPAKFTNE*

LD24265.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:50:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11161-PA 293 GF11161-PA 1..293 1..295 1446 92.9 Plus
Dana\GF11465-PA 299 GF11465-PA 3..299 14..295 374 33 Plus
Dana\GF11437-PA 280 GF11437-PA 33..280 48..295 286 29.7 Plus
Dana\GF17958-PA 375 GF17958-PA 5..266 8..256 272 30.4 Plus
Dana\GF20237-PA 318 GF20237-PA 27..287 22..265 264 30.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:50:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22466-PA 294 GG22466-PA 1..294 1..295 1509 97.3 Plus
Dere\GG22562-PA 299 GG22562-PA 17..299 22..295 376 34 Plus
Dere\GG20659-PA 285 GG20659-PA 20..284 23..294 292 28.2 Plus
Dere\GG18938-PA 378 GG18938-PA 55..269 50..269 262 30.2 Plus
Dere\GG19273-PA 314 GG19273-PA 57..279 55..261 245 30.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:50:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20865-PA 293 GH20865-PA 1..293 1..295 1382 87.5 Plus
Dgri\GH22640-PA 298 GH22640-PA 23..298 28..295 385 34.9 Plus
Dgri\GH21207-PA 382 GH21207-PA 49..271 42..269 276 30.2 Plus
Dgri\GH12615-PA 294 GH12615-PA 37..263 55..265 248 33.5 Plus
Dgri\GH21008-PA 274 GH21008-PA 16..267 25..288 246 30.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
Echs1-PA 295 CG6543-PA 1..295 1..295 1497 100 Plus
Echs1-PB 295 CG6543-PB 1..295 1..295 1497 100 Plus
CG8778-PA 299 CG8778-PA 7..299 11..295 376 34.5 Plus
CG6984-PA 285 CG6984-PA 38..285 48..295 297 28.9 Plus
CG5844-PA 378 CG5844-PA 47..269 42..269 259 29.7 Plus
CG5611-PC 326 CG5611-PC 17..236 18..234 252 31.5 Plus
CG5611-PA 326 CG5611-PA 17..236 18..234 252 31.5 Plus
CG9577-PA 312 CG9577-PA 55..277 55..261 240 31.4 Plus
Mtpalpha-PB 744 CG4389-PB 23..220 54..252 235 33.6 Plus
Mtpalpha-PA 783 CG4389-PA 62..259 54..252 235 33.6 Plus
CG5044-PA 385 CG5044-PA 47..218 45..215 205 31.6 Plus
CG5044-PB 386 CG5044-PB 48..219 45..215 205 31.6 Plus
Dci-PA 262 CG13890-PA 6..192 40..223 193 26.1 Plus
CG4594-PB 280 CG4594-PB 36..207 52..222 167 27.2 Plus
CG4594-PA 280 CG4594-PA 36..207 52..222 167 27.2 Plus
CG4598-PB 281 CG4598-PB 25..279 41..291 153 24.7 Plus
CG4598-PA 281 CG4598-PA 25..279 41..291 153 24.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:50:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20973-PA 293 GI20973-PA 1..293 1..295 1370 87.5 Plus
Dmoj\GI21154-PA 301 GI21154-PA 35..301 36..295 373 34.5 Plus
Dmoj\GI11030-PA 310 GI11030-PA 24..279 35..265 298 32.3 Plus
Dmoj\GI18602-PA 283 GI18602-PA 19..283 28..294 293 32.6 Plus
Dmoj\GI10483-PA 386 GI10483-PA 55..269 50..269 268 30.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:50:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16995-PA 296 GL16995-PA 1..296 1..295 1306 84.8 Plus
Dper\GL11030-PA 191 GL11030-PA 12..191 120..295 297 37.8 Plus
Dper\GL13079-PA 319 GL13079-PA 62..288 55..265 253 30.8 Plus
Dper\GL17233-PA 225 GL17233-PA 1..225 71..295 244 29.3 Plus
Dper\GL27313-PA 313 GL27313-PA 9..203 70..269 231 30.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:50:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19673-PB 296 GA19673-PB 1..296 1..295 1433 91.2 Plus
Dpse\GA19673-PA 296 GA19673-PA 1..296 1..295 1433 91.2 Plus
Dpse\GA21314-PA 298 GA21314-PA 35..298 39..295 375 34.8 Plus
Dpse\GA20005-PB 285 GA20005-PB 38..285 48..295 288 30.6 Plus
Dpse\GA19173-PA 379 GA19173-PA 47..269 42..269 270 30.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20252-PA 294 GM20252-PA 1..294 1..295 1523 98.6 Plus
Dsec\GM20345-PA 233 GM20345-PA 1..233 70..295 316 34.9 Plus
Dsec\GM21756-PA 285 GM21756-PA 20..285 23..295 284 27.7 Plus
Dsec\GM24034-PA 374 GM24034-PA 55..269 50..269 262 30.2 Plus
Dsec\GM16334-PA 326 GM16334-PA 50..236 51..234 240 34.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25738-PA 294 GD25738-PA 1..294 1..295 1523 98.6 Plus
Dsim\GD25824-PA 299 GD25824-PA 3..299 7..295 383 34 Plus
Dsim\GD18835-PA 378 GD18835-PA 55..269 50..269 262 30.2 Plus
Dsim\GD18069-PA 318 GD18069-PA 33..228 42..234 242 33.3 Plus
Dsim\GD11247-PA 226 GD11247-PA 1..226 70..295 235 26 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:50:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20693-PA 293 GJ20693-PA 1..293 1..295 1385 88.5 Plus
Dvir\GJ21004-PA 281 GJ21004-PA 15..281 36..295 376 35.3 Plus
Dvir\GJ15810-PA 313 GJ15810-PA 15..282 17..265 282 31.4 Plus
Dvir\GJ23164-PA 385 GJ23164-PA 47..269 42..269 272 30.2 Plus
Dvir\GJ21618-PA 254 GJ21618-PA 12..252 55..294 247 30.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17937-PA 295 GK17937-PA 1..295 1..295 1405 89.5 Plus
Dwil\GK15915-PA 302 GK15915-PA 4..302 15..295 387 33.6 Plus
Dwil\GK14405-PA 390 GK14405-PA 49..271 42..269 290 31.5 Plus
Dwil\GK25337-PA 317 GK25337-PA 60..286 55..265 286 33 Plus
Dwil\GK17869-PA 283 GK17869-PA 14..282 24..295 242 29.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13337-PA 294 GE13337-PA 1..294 1..295 1511 97.6 Plus
Dyak\GE13432-PA 299 GE13432-PA 17..299 22..295 376 34 Plus
Dyak\GE11645-PA 285 GE11645-PA 20..284 23..294 295 28.6 Plus
Dyak\GE26195-PA 378 GE26195-PA 55..269 50..269 262 30.2 Plus
Dyak\GE10552-PA 310 GE10552-PA 25..273 42..284 237 29.8 Plus