Clone LD24347 Report

Search the DGRC for LD24347

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:243
Well:47
Vector:pOT2
Associated Gene/TranscriptCG8636-RA
Protein status:LD24347.pep: gold
Preliminary Size:1300
Sequenced Size:1076

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8636 2001-01-01 Release 2 assignment
CG8636 2002-05-16 Blastp of sequenced clone
CG8636 2003-01-01 Sim4 clustering to Release 3
CG8636 2008-04-29 Release 5.5 accounting
CG8636 2008-08-15 Release 5.9 accounting
CG8636 2008-12-18 5.12 accounting

Clone Sequence Records

LD24347.complete Sequence

1076 bp (1076 high quality bases) assembled on 2002-05-16

GenBank Submission: AY118933

> LD24347.complete
CGGCAGGGTAACACTCTTTTGTTGCTGATTAAAAATCCGCTTAACTCGTG
GCGAAATTTGCATTTACGATTTCGCATACAAATCGCGTTGAAAATCAGAA
TGCCGGGCGTTGAAACGATCAAATCCTCCTGGGCGGACGAGGTGGAGCTC
GACTATGGTGGACTACCTCCGACGACGGAGACGGTGGAGAACGGACAGAA
GTACGTGACGGAGTACAAGTACAACAAGGACGACAAGAAGACGAAGGTGG
TGCGCACGTACAAGATATCCAAGCAGGTGGTGCCCAAGACGGTGGCCAAG
CGACGCACCTGGACGAAGTTCGGCGACTCGAAGAACGACAAGCCCGGCCC
CAACTCGCAGACGACCATGGTGTCCGAGGAGATCATCATGCAGTTCCTCA
ACTCCAAGGAGGACGAGAAGGCCAACGATCCGCTGCTAGATCCCACCAAG
AATATTGCCAAGTGCCGTATCTGCAACGGTGAGCATTGGTCGGTCAACTG
CCCGTACAAGGGCACGGCGATGGACACGAATATGATGGAGAAGAAGGCTT
CGGCAGCCGCCGCGGCCGCCGTCGATGCGCCCAAGTCCGGCAAGTATGTG
CCGCCGTTCCTCAAGGACAGCCAAAAGGGCGCGCTGGGAATGCGCGGACG
CGACGACACGGCCGCCATTAGGATATCGAATCTGTCGGAGTCGATGACCG
AGGCGGATCTCGAGGAGCTGGTGAAGAAGATTGGACCGCAGAGCAAGATG
TATCTCGCCCGCGACAAGAACACCGGACTCTGCAAGGGATTCGCCTACGT
GCACTTCAAGCAGCGCAAGGATGCGGCCGCCGCCATCGAGATCCTCAATG
GACACGGCTACGACCACTTGATCCTCAGCGTCGAATGGTCGAAACCCCAG
AACAATTAGTTAGTCCCGTTCCCACTACCCGCGTTTACTGCTCATAGGAG
TCCGTTCGAGTCGATCACACAATTTGTCCCTATGCTATGCTAAGTTTGCT
ACAAATAAATCTTAAAACAGCCCCCATGGGCACCGAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAA

LD24347.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:07:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG8636-RA 1289 CG8636-RA 150..1188 1..1039 5195 100 Plus
CG10881-RA 884 CG10881-RA 672..878 694..900 570 85 Plus
CG10881-RA 884 CG10881-RA 294..364 337..407 175 83 Plus
CG10881-RA 884 CG10881-RA 156..223 199..266 160 82.3 Plus
CG10881-RA 884 CG10881-RA 396..481 439..524 160 79 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:29:06
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2503031..2503966 1035..100 4560 99.1 Minus
chr3R 27901430 chr3R 16232894..16233100 694..900 570 85 Plus
chrX 22417052 chrX 2504030..2504128 99..1 495 100 Minus
chr3R 27901430 chr3R 16232378..16232703 199..524 370 74.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:15:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2609243..2610182 1039..100 4700 100 Minus
3R 32079331 3R 20408936..20409142 694..900 570 85 Plus
X 23542271 X 2610246..2610344 99..1 495 100 Minus
3R 32079331 3R 20408420..20408745 199..524 370 74.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:38:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2617341..2618280 1039..100 4700 100 Minus
3R 31820162 3R 20149767..20149973 694..900 570 85 Plus
X 23527363 X 2618344..2618442 99..1 495 100 Minus
3R 31820162 3R 20149389..20149459 337..407 175 83 Plus
3R 31820162 3R 20149251..20149318 199..266 160 82.3 Plus
3R 31820162 3R 20149491..20149576 439..524 160 79 Plus
Blast to na_te.dros performed on 2019-03-16 11:29:04 has no hits.

LD24347.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:30:09 Download gff for LD24347.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2503031..2503966 100..1035 99 <- Minus
chrX 2504030..2504128 1..99 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:02:18 Download gff for LD24347.complete
Subject Subject Range Query Range Percent Splice Strand
CG8636-RA 1..810 100..909 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:50:43 Download gff for LD24347.complete
Subject Subject Range Query Range Percent Splice Strand
CG8636-RA 1..810 100..909 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:22:16 Download gff for LD24347.complete
Subject Subject Range Query Range Percent Splice Strand
CG8636-RA 1..810 100..909 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:43:23 Download gff for LD24347.complete
Subject Subject Range Query Range Percent Splice Strand
CG8636-RA 1..810 100..909 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:17:59 Download gff for LD24347.complete
Subject Subject Range Query Range Percent Splice Strand
CG8636-RA 1..810 100..909 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:28:08 Download gff for LD24347.complete
Subject Subject Range Query Range Percent Splice Strand
CG8636-RA 19..1053 1..1035 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:50:43 Download gff for LD24347.complete
Subject Subject Range Query Range Percent Splice Strand
CG8636-RA 19..1053 1..1035 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:22:16 Download gff for LD24347.complete
Subject Subject Range Query Range Percent Splice Strand
CG8636-RA 1..1027 9..1035 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:43:23 Download gff for LD24347.complete
Subject Subject Range Query Range Percent Splice Strand
CG8636-RA 19..1053 1..1035 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:17:59 Download gff for LD24347.complete
Subject Subject Range Query Range Percent Splice Strand
CG8636-RA 1..1027 9..1035 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:30:09 Download gff for LD24347.complete
Subject Subject Range Query Range Percent Splice Strand
X 2609247..2610182 100..1035 100 <- Minus
X 2610246..2610344 1..99 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:30:09 Download gff for LD24347.complete
Subject Subject Range Query Range Percent Splice Strand
X 2609247..2610182 100..1035 100 <- Minus
X 2610246..2610344 1..99 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:30:09 Download gff for LD24347.complete
Subject Subject Range Query Range Percent Splice Strand
X 2609247..2610182 100..1035 100 <- Minus
X 2610246..2610344 1..99 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:22:16 Download gff for LD24347.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2503280..2504215 100..1035 100 <- Minus
arm_X 2504279..2504377 1..99 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:15:37 Download gff for LD24347.complete
Subject Subject Range Query Range Percent Splice Strand
X 2617345..2618280 100..1035 100 <- Minus
X 2618344..2618442 1..99 100   Minus

LD24347.hyp Sequence

Translation from 0 to 908

> LD24347.hyp
RQGNTLLLLIKNPLNSWRNLHLRFRIQIALKIRMPGVETIKSSWADEVEL
DYGGLPPTTETVENGQKYVTEYKYNKDDKKTKVVRTYKISKQVVPKTVAK
RRTWTKFGDSKNDKPGPNSQTTMVSEEIIMQFLNSKEDEKANDPLLDPTK
NIAKCRICNGEHWSVNCPYKGTAMDTNMMEKKASAAAAAAVDAPKSGKYV
PPFLKDSQKGALGMRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKM
YLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWSKPQ
NN*

LD24347.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:19:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG8636-PA 269 CG8636-PA 1..269 34..302 1417 100 Plus
CG10881-PA 273 CG10881-PA 1..272 37..300 989 70 Plus

LD24347.pep Sequence

Translation from 99 to 908

> LD24347.pep
MPGVETIKSSWADEVELDYGGLPPTTETVENGQKYVTEYKYNKDDKKTKV
VRTYKISKQVVPKTVAKRRTWTKFGDSKNDKPGPNSQTTMVSEEIIMQFL
NSKEDEKANDPLLDPTKNIAKCRICNGEHWSVNCPYKGTAMDTNMMEKKA
SAAAAAAVDAPKSGKYVPPFLKDSQKGALGMRGRDDTAAIRISNLSESMT
EADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILN
GHGYDHLILSVEWSKPQNN*

LD24347.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:16:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21942-PA 270 GF21942-PA 1..270 1..269 1396 96.7 Plus
Dana\GF23028-PA 269 GF23028-PA 4..268 7..267 968 72.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:16:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12605-PA 269 GG12605-PA 1..269 1..269 1433 98.9 Plus
Dere\GG23911-PA 273 GG23911-PA 1..272 4..267 984 72.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:16:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21559-PA 269 GH21559-PA 1..268 1..268 1338 94.4 Plus
Dgri\GH17624-PA 245 GH17624-PA 1..245 1..269 1243 87.7 Plus
Dgri\GH17626-PA 227 GH17626-PA 1..227 1..269 1054 79.2 Plus
Dgri\GH14150-PA 260 GH14150-PA 6..260 9..268 881 65.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
eIF3g1-PA 269 CG8636-PA 1..269 1..269 1417 100 Plus
eIF3g2-PA 273 CG10881-PA 1..272 4..267 989 70 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:16:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16065-PA 269 GI16065-PA 1..269 1..269 1423 97.4 Plus
Dmoj\GI22232-PA 259 GI22232-PA 6..259 9..268 918 70.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:16:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12937-PA 269 GL12937-PA 1..269 1..269 1408 96.7 Plus
Dper\GL23467-PA 276 GL23467-PA 4..275 7..267 923 69.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:16:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21226-PA 269 GA21226-PA 1..269 1..269 1408 96.7 Plus
Dpse\GA10616-PA 274 GA10616-PA 4..273 7..267 935 70.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:16:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18870-PA 269 GM18870-PA 1..269 1..269 1438 99.3 Plus
Dsec\GM23111-PA 273 GM23111-PA 1..272 4..267 974 70 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:16:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24609-PA 269 GD24609-PA 1..269 1..269 1438 99.3 Plus
Dsim\GD19352-PA 273 GD19352-PA 1..272 4..267 979 70.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:16:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15710-PA 269 GJ15710-PA 1..269 1..269 1420 97 Plus
Dvir\GJ23035-PA 259 GJ23035-PA 6..259 9..268 920 71 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:16:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16326-PA 269 GK16326-PA 1..269 1..269 1419 97 Plus
Dwil\GK22449-PA 268 GK22449-PA 4..267 7..268 1008 74.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:16:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16936-PA 269 GE16936-PA 1..269 1..269 1433 98.9 Plus
Dyak\GE25664-PA 273 GE25664-PA 1..272 4..267 986 71.3 Plus
Dyak\GE11159-PA 157 GE11159-PA 1..156 119..267 566 75.6 Plus