BDGP Sequence Production Resources |
Search the DGRC for LD24350
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 243 |
Well: | 50 |
Vector: | pOT2 |
Associated Gene/Transcript | RpL13-RA |
Protein status: | LD24350.pep: gold |
Sequenced Size: | 765 |
Gene | Date | Evidence |
---|---|---|
RpL13 | 2008-12-18 | 5.12 accounting |
765 bp assembled on 2008-12-08
GenBank Submission: BT053725.1
> LD24350.complete CCAATCTAAACCGCCAAGATGGGTAAGGGTAACAATATGATTCCGAATCA GCACTACCACAAGTGGTGGCAGCGGCATGTGAAGACCTGGTTCAACCAGC CGGCCCGCAAGGTCCGCAGGCATGCGAACCGCGTCAAGAAGGCTAAGGCC GTCTTCCCCCGCCCAGCCAGCGGTGCCCTGCGCCCTGTGGTTCGCTGCCC CACCATCCGCTACCACACCAAGCTGCGTGCCGGCCGTGGTTTCACCCTGG AGGAGCTGAAGGGTGCCGGCATTGGCGCCAACTTCGCCAAGACCATCGGC ATTGCCGTCGACAGGAGGCGCAAGAACAAATCCCTGGAGTCCCGCCAGCG TAACATCCAGCGCCTCAAGGAGTACCGCAGCAAGTTGATCCTGTTCCCCA TCAACGAGAAGAAGATCCGCGCCGGCGAGTCCTCTCTGGAGGAGTGCAAG CTGGCTACCCAGCTTAAGGGACCCGTCCTGCCCATCAAAAATGAGCAGCC CGCCGTGGTCGAGTTCCGTGAGGTGACCAAGGATGAGAAGAAGTTCAAGG CCTTCGCCACGCTGCGCAAGGCTCGCACTGATGCCCGTTTGGTCGGAATC CGCGCCAAGCGCGCCAAGGAGGCCGCTGAGAGCGAGGACGCCGCCAAGGG AGACCCCAAGAAGGCCAAGAAGTAAACCACATCTTAACCTGATCGTTCTG TCTACAACATCAACCAGAATAAAATCTTAGTTTTTCTTAAACGTGAAAAG AAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 9966866..9967177 | 260..571 | 1560 | 100 | Plus |
chr2L | 23010047 | chr2L | 9966546..9966807 | 1..262 | 1310 | 100 | Plus |
chr2L | 23010047 | chr2L | 9967244..9967422 | 569..747 | 895 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 9966546..9966806 | 1..261 | 100 | -> | Plus |
chr2L | 9966868..9967176 | 262..570 | 100 | -> | Plus |
chr2L | 9967246..9967424 | 571..750 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL13-RB | 1..657 | 19..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL13-RB | 1..657 | 19..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL13-RA | 1..657 | 19..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL13-RA | 1..657 | 19..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL13-RB | 30..778 | 1..749 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL13-RB | 30..778 | 1..749 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL13-RC | 288..1036 | 1..750 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL13-RC | 288..1036 | 1..750 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 9967617..9967877 | 1..261 | 100 | -> | Plus |
2L | 9967939..9968247 | 262..570 | 100 | -> | Plus |
2L | 9968317..9968495 | 571..750 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 9967617..9967877 | 1..261 | 100 | -> | Plus |
2L | 9967939..9968247 | 262..570 | 100 | -> | Plus |
2L | 9968317..9968495 | 571..750 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 9967617..9967877 | 1..261 | 100 | -> | Plus |
2L | 9967939..9968247 | 262..570 | 100 | -> | Plus |
2L | 9968317..9968495 | 571..750 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 9967617..9967877 | 1..261 | 100 | -> | Plus |
arm_2L | 9967939..9968247 | 262..570 | 100 | -> | Plus |
arm_2L | 9968317..9968495 | 571..750 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 9967617..9967877 | 1..261 | 100 | -> | Plus |
2L | 9967939..9968247 | 262..570 | 100 | -> | Plus |
2L | 9968317..9968495 | 571..750 | 98 | Plus |
Translation from 18 to 674
> LD24350.pep MGKGNNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPA SGALRPVVRCPTIRYHTKLRAGRGFTLEELKGAGIGANFAKTIGIAVDRR RKNKSLESRQRNIQRLKEYRSKLILFPINEKKIRAGESSLEECKLATQLK GPVLPIKNEQPAVVEFREVTKDEKKFKAFATLRKARTDARLVGIRAKRAK EAAESEDAAKGDPKKAKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15733-PA | 218 | GF15733-PA | 1..218 | 1..218 | 1089 | 94.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10074-PA | 218 | GG10074-PA | 1..218 | 1..218 | 1131 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11063-PA | 217 | GH11063-PA | 1..207 | 1..208 | 972 | 88 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL13-PC | 218 | CG4651-PC | 1..218 | 1..218 | 1126 | 100 | Plus |
RpL13-PB | 218 | CG4651-PB | 1..218 | 1..218 | 1126 | 100 | Plus |
RpL13-PA | 218 | CG4651-PA | 1..218 | 1..218 | 1126 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17580-PA | 218 | GI17580-PA | 1..208 | 1..208 | 1000 | 89.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18951-PA | 217 | GL18951-PA | 1..217 | 1..218 | 1046 | 92.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18330-PA | 217 | GA18330-PA | 1..217 | 1..218 | 1046 | 92.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17848-PA | 218 | GM17848-PA | 1..218 | 1..218 | 1131 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23645-PA | 218 | GD23645-PA | 1..218 | 1..218 | 1131 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17923-PA | 217 | GJ17923-PA | 1..207 | 1..208 | 995 | 89.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15580-PA | 217 | GK15580-PA | 1..207 | 1..208 | 989 | 89.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\RpL13-PA | 218 | GE18887-PA | 1..218 | 1..218 | 1131 | 99.5 | Plus |
Translation from 18 to 674
> LD24350.hyp MGKGNNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPA SGALRPVVRCPTIRYHTKLRAGRGFTLEELKGAGIGANFAKTIGIAVDRR RKNKSLESRQRNIQRLKEYRSKLILFPINEKKIRAGESSLEECKLATQLK GPVLPIKNEQPAVVEFREVTKDEKKFKAFATLRKARTDARLVGIRAKRAK EAAESEDAAKGDPKKAKK*