Clone LD24350 Report

Search the DGRC for LD24350

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:243
Well:50
Vector:pOT2
Associated Gene/TranscriptRpL13-RA
Protein status:LD24350.pep: gold
Sequenced Size:765

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
RpL13 2008-12-18 5.12 accounting

Clone Sequence Records

LD24350.complete Sequence

765 bp assembled on 2008-12-08

GenBank Submission: BT053725.1

> LD24350.complete
CCAATCTAAACCGCCAAGATGGGTAAGGGTAACAATATGATTCCGAATCA
GCACTACCACAAGTGGTGGCAGCGGCATGTGAAGACCTGGTTCAACCAGC
CGGCCCGCAAGGTCCGCAGGCATGCGAACCGCGTCAAGAAGGCTAAGGCC
GTCTTCCCCCGCCCAGCCAGCGGTGCCCTGCGCCCTGTGGTTCGCTGCCC
CACCATCCGCTACCACACCAAGCTGCGTGCCGGCCGTGGTTTCACCCTGG
AGGAGCTGAAGGGTGCCGGCATTGGCGCCAACTTCGCCAAGACCATCGGC
ATTGCCGTCGACAGGAGGCGCAAGAACAAATCCCTGGAGTCCCGCCAGCG
TAACATCCAGCGCCTCAAGGAGTACCGCAGCAAGTTGATCCTGTTCCCCA
TCAACGAGAAGAAGATCCGCGCCGGCGAGTCCTCTCTGGAGGAGTGCAAG
CTGGCTACCCAGCTTAAGGGACCCGTCCTGCCCATCAAAAATGAGCAGCC
CGCCGTGGTCGAGTTCCGTGAGGTGACCAAGGATGAGAAGAAGTTCAAGG
CCTTCGCCACGCTGCGCAAGGCTCGCACTGATGCCCGTTTGGTCGGAATC
CGCGCCAAGCGCGCCAAGGAGGCCGCTGAGAGCGAGGACGCCGCCAAGGG
AGACCCCAAGAAGGCCAAGAAGTAAACCACATCTTAACCTGATCGTTCTG
TCTACAACATCAACCAGAATAAAATCTTAGTTTTTCTTAAACGTGAAAAG
AAAAAAAAAAAAAAA

LD24350.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
RpL13-RB 1291 RpL13-RB 67..813 1..747 3735 100 Plus
RpL13-RA 1291 RpL13-RA 67..813 1..747 3735 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:05:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9966866..9967177 260..571 1560 100 Plus
chr2L 23010047 chr2L 9966546..9966807 1..262 1310 100 Plus
chr2L 23010047 chr2L 9967244..9967422 569..747 895 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:15:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9967937..9968248 260..571 1560 100 Plus
2L 23513712 2L 9967617..9967878 1..262 1310 100 Plus
2L 23513712 2L 9968315..9968493 569..747 895 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:15
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9967937..9968248 260..571 1560 100 Plus
2L 23513712 2L 9967617..9967878 1..262 1310 100 Plus
2L 23513712 2L 9968315..9968493 569..747 895 100 Plus
Blast to na_te.dros performed on 2019-03-15 21:05:39 has no hits.

LD24350.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:06:50 Download gff for LD24350.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9966546..9966806 1..261 100 -> Plus
chr2L 9966868..9967176 262..570 100 -> Plus
chr2L 9967246..9967424 571..750 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:00:12 Download gff for LD24350.complete
Subject Subject Range Query Range Percent Splice Strand
RpL13-RB 1..657 19..675 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:21:21 Download gff for LD24350.complete
Subject Subject Range Query Range Percent Splice Strand
RpL13-RB 1..657 19..675 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:37:20 Download gff for LD24350.complete
Subject Subject Range Query Range Percent Splice Strand
RpL13-RA 1..657 19..675 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:43:16 Download gff for LD24350.complete
Subject Subject Range Query Range Percent Splice Strand
RpL13-RA 1..657 19..675 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-08 16:52:12 Download gff for LD24350.complete
Subject Subject Range Query Range Percent Splice Strand
RpL13-RB 30..778 1..749 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:21:21 Download gff for LD24350.complete
Subject Subject Range Query Range Percent Splice Strand
RpL13-RB 30..778 1..749 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:37:20 Download gff for LD24350.complete
Subject Subject Range Query Range Percent Splice Strand
RpL13-RC 288..1036 1..750 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:43:16 Download gff for LD24350.complete
Subject Subject Range Query Range Percent Splice Strand
RpL13-RC 288..1036 1..750 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:06:50 Download gff for LD24350.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9967617..9967877 1..261 100 -> Plus
2L 9967939..9968247 262..570 100 -> Plus
2L 9968317..9968495 571..750 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:06:50 Download gff for LD24350.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9967617..9967877 1..261 100 -> Plus
2L 9967939..9968247 262..570 100 -> Plus
2L 9968317..9968495 571..750 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:06:50 Download gff for LD24350.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9967617..9967877 1..261 100 -> Plus
2L 9967939..9968247 262..570 100 -> Plus
2L 9968317..9968495 571..750 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:37:20 Download gff for LD24350.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9967617..9967877 1..261 100 -> Plus
arm_2L 9967939..9968247 262..570 100 -> Plus
arm_2L 9968317..9968495 571..750 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:52:58 Download gff for LD24350.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9967617..9967877 1..261 100 -> Plus
2L 9967939..9968247 262..570 100 -> Plus
2L 9968317..9968495 571..750 98   Plus

LD24350.pep Sequence

Translation from 18 to 674

> LD24350.pep
MGKGNNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPA
SGALRPVVRCPTIRYHTKLRAGRGFTLEELKGAGIGANFAKTIGIAVDRR
RKNKSLESRQRNIQRLKEYRSKLILFPINEKKIRAGESSLEECKLATQLK
GPVLPIKNEQPAVVEFREVTKDEKKFKAFATLRKARTDARLVGIRAKRAK
EAAESEDAAKGDPKKAKK*

LD24350.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:29:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15733-PA 218 GF15733-PA 1..218 1..218 1089 94.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10074-PA 218 GG10074-PA 1..218 1..218 1131 99.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11063-PA 217 GH11063-PA 1..207 1..208 972 88 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:16
Subject Length Description Subject Range Query Range Score Percent Strand
RpL13-PC 218 CG4651-PC 1..218 1..218 1126 100 Plus
RpL13-PB 218 CG4651-PB 1..218 1..218 1126 100 Plus
RpL13-PA 218 CG4651-PA 1..218 1..218 1126 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:29:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17580-PA 218 GI17580-PA 1..208 1..208 1000 89.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:29:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18951-PA 217 GL18951-PA 1..217 1..218 1046 92.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:29:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18330-PA 217 GA18330-PA 1..217 1..218 1046 92.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17848-PA 218 GM17848-PA 1..218 1..218 1131 99.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23645-PA 218 GD23645-PA 1..218 1..218 1131 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17923-PA 217 GJ17923-PA 1..207 1..208 995 89.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15580-PA 217 GK15580-PA 1..207 1..208 989 89.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpL13-PA 218 GE18887-PA 1..218 1..218 1131 99.5 Plus

LD24350.hyp Sequence

Translation from 18 to 674

> LD24350.hyp
MGKGNNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPA
SGALRPVVRCPTIRYHTKLRAGRGFTLEELKGAGIGANFAKTIGIAVDRR
RKNKSLESRQRNIQRLKEYRSKLILFPINEKKIRAGESSLEECKLATQLK
GPVLPIKNEQPAVVEFREVTKDEKKFKAFATLRKARTDARLVGIRAKRAK
EAAESEDAAKGDPKKAKK*

LD24350.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:56:13
Subject Length Description Subject Range Query Range Score Percent Strand
RpL13-PC 218 CG4651-PC 1..218 1..218 1126 100 Plus
RpL13-PB 218 CG4651-PB 1..218 1..218 1126 100 Plus
RpL13-PA 218 CG4651-PA 1..218 1..218 1126 100 Plus