Clone LD24355 Report

Search the DGRC for LD24355

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:243
Well:55
Vector:pOT2
Associated Gene/TranscriptCG3163-RA
Protein status:LD24355.pep: gold
Preliminary Size:1300
Sequenced Size:1203

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3163 2001-01-01 Release 2 assignment
CG3163 2002-05-15 Blastp of sequenced clone
CG3163 2003-01-01 Sim4 clustering to Release 3
CG3163 2008-04-29 Release 5.5 accounting
CG3163 2008-08-15 Release 5.9 accounting
CG3163 2008-12-18 5.12 accounting

Clone Sequence Records

LD24355.complete Sequence

1203 bp (1203 high quality bases) assembled on 2002-05-15

GenBank Submission: AY118934

> LD24355.complete
AAAAAATGGACTTTATCGACGACTTCATCGAAGAATACAAAAGCAATCCG
TGCTTGTGGAAGGCGGACTCGGCGGACTTCAGGAACCGCAGCCGCCGGCA
GGAGGCCTACGCGAAGCTCATCGAGGTGGCCACCAAGCACGGGGAGATGT
ACAATGTGGAGCGAACAAAGCAAAAGATAAACAATCTGCGCTGTGCATTT
CGTCATCAGCTGAGGAAATACAACGAGGTCAAGAAAAAGGGCGAGAAGTA
CGAGCCCTACTGCCCCAAGCGCCGCTACTTCGAGTCCCTGATGTTCCTTA
AGGACGAGGAGATCCCCGCCGACAAGAAGTTCAAGCGCGAGCAGTCGGTC
TGCCTGGACAACTCCATGCAGCTAGGGGCGCCAGAGAACGGCGACGAGTA
TTCCGACGCCGAGAGCCTGCACAAGCCCCCAAAGCCGACGGCAGACTCGA
TCAAGATGTCACCCAACAACAGCGCCAACGAATTCTGTGCCAACATCTTC
GAGGAGGCCGCCGCCGCCGCTGCCGCTGACCCCGTTATCAGTATTAAAAC
AGTCAACAACGCCAACAGCCATGCCAGTGGCGCTACTATCAAGGAGGTCG
AAATCGTGGTGCCTGCTAACAACAGGCTGCTGTCCGCCCGCAGAAAATCC
GTGCCCGACTCCATAAAGTCTCCGCCTGGCGACTCCGAATCGCCGCAGTG
CAAGCGCATCGTCACCCAGAACCAAACGAAACTGATCAGTAATCAGAGCC
CGAGCCAGAAAGCCAATCACATAACACGGAAAAGGTCCTCCTCGGTCTCT
TCGCAGATTTCGGAGGACAACGAGCCGCCTCCAGGTAAATTCCGAGCGGA
CATTTCCACCATTGACTTTGAGCGCCTCTTTTCGCTGGCCCTAAAGAGTG
CGGACAGCCAGCTGGACGACCACTTCTCCAACTTCGGGAAAATTATCGCA
CACAAGCTTCGCTCCATGGACGGAACACAGGCTATCTACGCGGAAAAGAT
CATCGCCGATGTGCTGTACCAGGGCCAGATGAAAATGCTGTCCTCGCTGA
GTATACACCAGTTTATGGGCGTGGACAATGCAACAGTTTACCTAGAGAGC
CACAGTAAATGATGGCCTGGCCCCTTTAAAGACGTACTTTTAGAGTTTAT
GTAATAATAAGATGTAAAGAGACAGTCATGTGTAAAAAAAAAAAAAAAAA
AAA

LD24355.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:07:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG3163-RA 1235 CG3163-RA 53..1235 1..1183 5915 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:24:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19915445..19916621 1..1183 5775 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:15:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:24:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24029373..24030560 1..1188 5925 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:38:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24030572..24031759 1..1188 5925 99.9 Plus
Blast to na_te.dros performed on 2019-03-15 22:24:18 has no hits.

LD24355.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:25:02 Download gff for LD24355.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19915445..19916621 1..1183 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:02:19 Download gff for LD24355.complete
Subject Subject Range Query Range Percent Splice Strand
CG3163-RA 1..1107 6..1112 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:51:14 Download gff for LD24355.complete
Subject Subject Range Query Range Percent Splice Strand
CG3163-RA 1..1107 6..1112 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:18:23 Download gff for LD24355.complete
Subject Subject Range Query Range Percent Splice Strand
CG3163-RA 1..1107 6..1112 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:43:52 Download gff for LD24355.complete
Subject Subject Range Query Range Percent Splice Strand
CG3163-RA 1..1107 6..1112 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:21:24 Download gff for LD24355.complete
Subject Subject Range Query Range Percent Splice Strand
CG3163-RA 1..1107 6..1112 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:28:58 Download gff for LD24355.complete
Subject Subject Range Query Range Percent Splice Strand
CG3163-RA 53..1235 1..1183 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:51:14 Download gff for LD24355.complete
Subject Subject Range Query Range Percent Splice Strand
CG3163-RA 53..1235 1..1183 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:18:23 Download gff for LD24355.complete
Subject Subject Range Query Range Percent Splice Strand
CG3163-RA 57..1239 1..1183 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:43:52 Download gff for LD24355.complete
Subject Subject Range Query Range Percent Splice Strand
CG3163-RA 53..1235 1..1183 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:21:24 Download gff for LD24355.complete
Subject Subject Range Query Range Percent Splice Strand
CG3163-RA 57..1239 1..1183 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:25:02 Download gff for LD24355.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24029373..24030555 1..1183 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:25:02 Download gff for LD24355.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24029373..24030555 1..1183 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:25:02 Download gff for LD24355.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24029373..24030555 1..1183 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:18:23 Download gff for LD24355.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19916896..19918078 1..1183 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:16:09 Download gff for LD24355.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24030590..24031772 1..1183 100   Plus

LD24355.hyp Sequence

Translation from 2 to 1111

> LD24355.hyp
KMDFIDDFIEEYKSNPCLWKADSADFRNRSRRQEAYAKLIEVATKHGEMY
NVERTKQKINNLRCAFRHQLRKYNEVKKKGEKYEPYCPKRRYFESLMFLK
DEEIPADKKFKREQSVCLDNSMQLGAPENGDEYSDAESLHKPPKPTADSI
KMSPNNSANEFCANIFEEAAAAAAADPVISIKTVNNANSHASGATIKEVE
IVVPANNRLLSARRKSVPDSIKSPPGDSESPQCKRIVTQNQTKLISNQSP
SQKANHITRKRSSSVSSQISEDNEPPPGKFRADISTIDFERLFSLALKSA
DSQLDDHFSNFGKIIAHKLRSMDGTQAIYAEKIIADVLYQGQMKMLSSLS
IHQFMGVDNATVYLESHSK*

LD24355.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG3163-PA 368 CG3163-PA 1..368 2..369 1896 100 Plus
CG5180-PC 355 CG5180-PC 12..350 4..352 215 22.9 Plus
CG5180-PB 355 CG5180-PB 12..350 4..352 215 22.9 Plus
CG8281-PA 348 CG8281-PA 22..198 4..160 152 25.6 Plus

LD24355.pep Sequence

Translation from 5 to 1111

> LD24355.pep
MDFIDDFIEEYKSNPCLWKADSADFRNRSRRQEAYAKLIEVATKHGEMYN
VERTKQKINNLRCAFRHQLRKYNEVKKKGEKYEPYCPKRRYFESLMFLKD
EEIPADKKFKREQSVCLDNSMQLGAPENGDEYSDAESLHKPPKPTADSIK
MSPNNSANEFCANIFEEAAAAAAADPVISIKTVNNANSHASGATIKEVEI
VVPANNRLLSARRKSVPDSIKSPPGDSESPQCKRIVTQNQTKLISNQSPS
QKANHITRKRSSSVSSQISEDNEPPPGKFRADISTIDFERLFSLALKSAD
SQLDDHFSNFGKIIAHKLRSMDGTQAIYAEKIIADVLYQGQMKMLSSLSI
HQFMGVDNATVYLESHSK*

LD24355.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:32:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12893-PA 370 GF12893-PA 1..370 1..368 1375 75.8 Plus
Dana\GF21386-PA 511 GF21386-PA 173..268 1..102 157 35.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:32:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22924-PA 366 GG22924-PA 1..366 1..368 1749 92.7 Plus
Dere\GG17737-PA 534 GG17737-PA 185..524 1..346 166 26.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:32:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20173-PA 360 GH20173-PA 1..360 1..368 1132 65.2 Plus
Dgri\GH12134-PA 398 GH12134-PA 11..111 3..102 154 37.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG3163-PA 368 CG3163-PA 1..368 1..368 1896 100 Plus
CG5180-PC 355 CG5180-PC 12..350 3..351 215 22.9 Plus
CG5180-PB 355 CG5180-PB 12..350 3..351 215 22.9 Plus
CG8281-PA 348 CG8281-PA 22..198 3..159 152 25.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:32:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20699-PA 360 GI20699-PA 1..360 1..368 1156 64.7 Plus
Dmoj\GI12053-PA 234 GI12053-PA 8..104 2..101 161 36.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:32:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11653-PA 356 GL11653-PA 1..356 1..368 1236 70.5 Plus
Dper\GL13562-PA 347 GL13562-PA 12..340 3..346 170 24.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:32:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16346-PA 356 GA16346-PA 1..356 1..368 1231 70.2 Plus
Dpse\GA18714-PA 347 GA18714-PA 12..340 3..346 170 24.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:32:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18291-PA 368 GM18291-PA 1..368 1..368 1933 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:32:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20438-PA 358 GJ20438-PA 1..355 1..365 1127 64.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:32:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21384-PA 368 GK21384-PA 1..368 1..368 1213 66.7 Plus
Dwil\GK18054-PA 379 GK18054-PA 29..144 3..118 154 31.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14362-PA 367 GE14362-PA 1..367 1..368 1726 91.1 Plus