Clone LD24440 Report

Search the DGRC for LD24440

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:244
Well:40
Vector:pOT2
Associated Gene/TranscriptUch-L5-RA
Protein status:LD24440.pep: gold
Preliminary Size:1160
Sequenced Size:1153

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3431 2001-01-01 Release 2 assignment
CG3431 2002-12-11 Blastp of sequenced clone
Uch-L3 2008-04-29 Release 5.5 accounting
Uch-L3 2008-08-15 Release 5.9 accounting
Uch-L3 2008-12-18 5.12 accounting

Clone Sequence Records

LD24440.complete Sequence

1153 bp (1153 high quality bases) assembled on 2002-12-11

GenBank Submission: AF132567

> LD24440.complete
TTGGTTCACTCTGTGAGTTGACAGAAAATTTTGTGCAGTAAAAGCACCAT
TTTTGTAGCGAAATCTATAGTAGAAAGATATTCAAGTGACTACTATTAAC
ATGGGCGACGGTGCTGGAAATTGGTGTCTCATTGAATCCGATCCCGGGGT
ATTCACAGAGCTTATTCGCGAATTCGGATGCGATGGGGCACAGGTGGAGG
AGATCTGGAGTCTCGACAGCGAGTCCTTCAAGAACCTAGAGCCCATCCAT
GGTCTGATCTTCCTGTTCAAGTGGGTGCAGGAGGATGAACCCGCTGGAAA
AGTGGTCCTGGATCGGGAGAACATCTTCTTTGCCAAGCAGGTGATCAACA
ACGCATGCGCCACCCAGGCGATCTTGAGCCTCCTGATGAACCTGGATCAT
GAGGACATCAAATTGGGCGAGACCCTCACCAATTTTAAGGAGTTCTGCCA
GTGCTTCGATCCGTACAACAAGGGATTAACTTTGAGCAACGCTAGCCAGA
TTCGCACGGTGCACAACTCCTTTGCTCGCCCAACACTCTTCGAGCTGGAC
ACTAAGAACCAGAAGAAGGACGATGACGTGTACCACTTTGTCGGCTATAT
GCCCATCGGAGGAAGACTGTACGAGCTGGACGGCCTGAGGGAGGGACCCA
TTGATCTTGGTGAGATCAAGTCGGAGCAGAACTGGATCGATGTGGTGCGT
CCGATTATTGAGAAGCGCATGCAGCGCTACAGCGACGGCGAGATCCACTT
CAATCTGATGGCTCTGATCTCGGACAGGCAGCGCATTTATGAACAGCAGA
TTGAGAAGCTGCTTAATCCGGCGCCCAATGCTATGGACACTGAGGAGGAT
CGACAGGCGGAGATCAGTAGCTTGCGCACGTACATAGAGTACGAGATTCA
GAAAAAGAAGCGCTACAAAGTGGAGAATGTGCGGCGCAAGCACAACTATT
TGCCCTTCATCGTGGAGCTCTTAAAAATTCTGGGCGAGAACGGACAACTA
ATGCCCATCTACGAGAAGGCCAAGCAGAGGGCGCTAGAACGCGAGCAGGC
GCAGCGCAAAAAGGATACCGACTAAGCATTTACAGTATATATTTAAAATT
TCCCGTTGGACAATTTAAAATTGCTGCGATATTTGAAAAAAAAAAAAAAA
AAA

LD24440.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:29:36
Subject Length Description Subject Range Query Range Score Percent Strand
Uch-L3-RA 1448 Uch-L3-RA 55..1204 1..1150 5720 99.8 Plus
Uch-L3.a 1374 Uch-L3.a 39..1130 59..1150 5430 99.8 Plus
CG1950-RA 1298 CG1950-RA 738..835 677..774 265 84.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:49:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9467616..9468575 1135..176 4770 99.8 Minus
chr3L 24539361 chr3L 9468653..9468829 177..1 885 100 Minus
chrX 22417052 chrX 11946845..11947038 774..581 280 76.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:15:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:49:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9475719..9476693 1150..176 4845 99.8 Minus
3L 28110227 3L 9476771..9476947 177..1 885 100 Minus
X 23542271 X 12055801..12055994 774..581 295 76.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9468819..9469793 1150..176 4845 99.7 Minus
3L 28103327 3L 9469871..9470047 177..1 885 100 Minus
X 23527363 X 12063899..12063996 774..677 265 84.6 Minus
Blast to na_te.dros performed on 2019-03-16 00:49:01 has no hits.

LD24440.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:49:50 Download gff for LD24440.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9467616..9468574 177..1135 99 <- Minus
chr3L 9468654..9468829 1..176 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:02:27 Download gff for LD24440.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-L3-RA 1..975 101..1075 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:00:32 Download gff for LD24440.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-L3-RA 1..975 101..1075 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:58:31 Download gff for LD24440.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-L5-RA 1..975 101..1075 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:51:04 Download gff for LD24440.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-L3-RA 1..975 101..1075 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:14:05 Download gff for LD24440.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-L5-RA 1..975 101..1075 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:17:49 Download gff for LD24440.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-L3-RA 27..1161 1..1135 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:00:32 Download gff for LD24440.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-L3-RA 27..1161 1..1135 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:58:31 Download gff for LD24440.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-L5-RA 19..1153 1..1135 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:51:04 Download gff for LD24440.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-L3-RA 27..1161 1..1135 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:14:05 Download gff for LD24440.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-L5-RA 19..1153 1..1135 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:49:50 Download gff for LD24440.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9475734..9476692 177..1135 100 <- Minus
3L 9476772..9476947 1..176 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:49:50 Download gff for LD24440.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9475734..9476692 177..1135 100 <- Minus
3L 9476772..9476947 1..176 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:49:50 Download gff for LD24440.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9475734..9476692 177..1135 100 <- Minus
3L 9476772..9476947 1..176 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:58:31 Download gff for LD24440.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9468834..9469792 177..1135 100 <- Minus
arm_3L 9469872..9470047 1..176 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:22:53 Download gff for LD24440.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9468834..9469792 177..1135 100 <- Minus
3L 9469872..9470047 1..176 100   Minus

LD24440.pep Sequence

Translation from 100 to 1074

> LD24440.pep
MGDGAGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDSESFKNLEPIH
GLIFLFKWVQEDEPAGKVVLDRENIFFAKQVINNACATQAILSLLMNLDH
EDIKLGETLTNFKEFCQCFDPYNKGLTLSNASQIRTVHNSFARPTLFELD
TKNQKKDDDVYHFVGYMPIGGRLYELDGLREGPIDLGEIKSEQNWIDVVR
PIIEKRMQRYSDGEIHFNLMALISDRQRIYEQQIEKLLNPAPNAMDTEED
RQAEISSLRTYIEYEIQKKKRYKVENVRRKHNYLPFIVELLKILGENGQL
MPIYEKAKQRALEREQAQRKKDTD*

LD24440.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:59:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24661-PA 324 GF24661-PA 1..324 1..324 1643 93.8 Plus
Dana\GF19511-PA 413 GF19511-PA 25..330 6..313 1182 69.6 Plus
Dana\GF12763-PA 470 GF12763-PA 41..417 5..318 462 32.2 Plus
Dana\GF15299-PA 227 GF15299-PA 2..224 6..224 169 25.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14033-PA 324 GG14033-PA 1..324 1..324 1665 95.7 Plus
Dere\GG19562-PA 335 GG19562-PA 16..323 6..316 1081 66 Plus
Dere\GG22294-PA 471 GG22294-PA 39..419 1..318 461 32 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16209-PA 324 GH16209-PA 1..324 1..324 1532 89.5 Plus
Dgri\GH22997-PA 462 GH22997-PA 23..375 1..300 459 33.1 Plus
Dgri\GH11470-PA 229 GH11470-PA 4..226 8..224 159 25.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:50
Subject Length Description Subject Range Query Range Score Percent Strand
Uch-L5-PB 324 CG3431-PB 1..324 1..324 1701 100 Plus
Uch-L5-PA 324 CG3431-PA 1..324 1..324 1701 100 Plus
Uch-L5R-PA 340 CG1950-PA 22..325 5..311 1048 63.8 Plus
calypso-PA 471 CG8445-PA 39..393 1..300 444 31.9 Plus
calypso-PB 471 CG8445-PB 39..393 1..300 444 31.9 Plus
Uch-PC 224 CG4265-PC 4..224 8..227 183 26.8 Plus
Uch-PB 227 CG4265-PB 4..227 8..227 182 26.4 Plus
Uch-PA 227 CG4265-PA 4..227 8..227 182 26.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:59:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13355-PA 324 GI13355-PA 1..324 1..324 1587 90.1 Plus
Dmoj\GI18963-PA 461 GI18963-PA 23..399 1..318 468 32.5 Plus
Dmoj\GI16929-PA 229 GI16929-PA 2..229 6..227 197 27.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17965-PA 324 GL17965-PA 1..324 1..324 1615 91.7 Plus
Dper\GL20225-PA 351 GL20225-PA 25..340 7..316 978 57.5 Plus
Dper\GL10684-PA 475 GL10684-PA 38..418 1..318 454 32 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17448-PA 324 GA17448-PA 1..324 1..324 1615 91.7 Plus
Dpse\GA26899-PA 351 GA26899-PA 25..340 7..316 983 57.5 Plus
Dpse\GA21084-PA 475 GA21084-PA 38..418 1..318 454 32 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24867-PA 324 GM24867-PA 1..324 1..324 1707 98.5 Plus
Dsec\GM13220-PA 340 GM13220-PA 21..325 4..311 1045 62.3 Plus
Dsec\GM20083-PA 471 GM20083-PA 39..419 1..318 463 32 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12919-PA 324 GD12919-PA 1..324 1..324 1716 98.8 Plus
Dsim\GD15942-PA 426 GD15942-PA 105..411 2..311 1050 61.7 Plus
Dsim\GD25561-PA 471 GD25561-PA 39..415 1..314 462 32.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13185-PA 325 GJ13185-PA 1..325 1..324 1528 88 Plus
Dvir\GJ20906-PA 462 GJ20906-PA 23..401 1..318 466 32.3 Plus
Dvir\GJ17211-PA 229 GJ17211-PA 4..229 8..227 181 27.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:59:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20334-PA 324 GK20334-PA 1..324 1..324 1577 89.5 Plus
Dwil\GK16481-PA 376 GK16481-PA 27..345 5..312 1116 65.2 Plus
Dwil\GK22163-PA 435 GK22163-PA 6..383 1..318 448 31.8 Plus
Dwil\GK15133-PA 227 GK15133-PA 2..224 6..224 198 26.5 Plus
Dwil\GK22136-PA 147 GK22136-PA 54..145 7..88 143 38.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:59:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21236-PA 324 GE21236-PA 1..324 1..324 1670 96 Plus
Dyak\GE16722-PA 329 GE16722-PA 16..329 6..322 1122 66.7 Plus
Dyak\GE14091-PA 471 GE14091-PA 39..419 1..318 463 32 Plus
Dyak\GE15202-PA 227 GE15202-PA 3..224 7..224 190 26.2 Plus

LD24440.hyp Sequence

Translation from 100 to 1074

> LD24440.hyp
MGDGAGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDSESFKNLEPIH
GLIFLFKWVQEDEPAGKVVLDRENIFFAKQVINNACATQAILSLLMNLDH
EDIKLGETLTNFKEFCQCFDPYNKGLTLSNASQIRTVHNSFARPTLFELD
TKNQKKDDDVYHFVGYMPIGGRLYELDGLREGPIDLGEIKSEQNWIDVVR
PIIEKRMQRYSDGEIHFNLMALISDRQRIYEQQIEKLLNPAPNAMDTEED
RQAEISSLRTYIEYEIQKKKRYKVENVRRKHNYLPFIVELLKILGENGQL
MPIYEKAKQRALEREQAQRKKDTD*

LD24440.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
Uch-L5-PB 324 CG3431-PB 1..324 1..324 1701 100 Plus
Uch-L5-PA 324 CG3431-PA 1..324 1..324 1701 100 Plus
Uch-L5R-PA 340 CG1950-PA 22..325 5..311 1048 63.8 Plus
calypso-PA 471 CG8445-PA 39..393 1..300 444 31.9 Plus
calypso-PB 471 CG8445-PB 39..393 1..300 444 31.9 Plus