Clone LD24633 Report

Search the DGRC for LD24633

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:246
Well:33
Vector:pOT2
Associated Gene/TranscriptProsbeta7-RA
Protein status:LD24633.pep: gold
Preliminary Size:1300
Sequenced Size:1004

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12000 2001-01-01 Release 2 assignment
CG12000 2002-05-17 Blastp of sequenced clone
CG12000 2003-01-01 Sim4 clustering to Release 3
Prosbeta4 2008-04-29 Release 5.5 accounting
Prosbeta4 2008-08-15 Release 5.9 accounting
Prosbeta4 2008-12-18 5.12 accounting

Clone Sequence Records

LD24633.complete Sequence

1004 bp (1004 high quality bases) assembled on 2002-05-17

GenBank Submission: AY118936

> LD24633.complete
CCGGCAGCGACAAACATTTCAAAGTCTCGCGTTATTCCAGTCTCCGAATA
AATTAGCATGTTGAACAACTACAACAGCCTAGCGCAGCCCATGTGGCAGA
ACGGACCCGCTCCCGGCGAGTTCTACAACTTCACGGGCGGACAGACGCCG
GTCCAGCAGCTACCGCGGGAGCTGACCACAATGGGACCCTATGGAACCAA
GCACAGCACTGCTTCCAGCACCACGGGCACTTCCGTGCTTGGCATTCGCT
ATGATTCAGGAGTGATGCTGGCCGCCGACACCCTGGTGTCTTACGGATCC
ATGGCCCGCTACCAAAACATTGAGCGCGTCTTTAAGGTCAACAAGAACAT
CCTGCTCGGCGGGAGCGGCGACTTCGCTGACATCCAGTCCATCAAGCGCA
ACATCGACCAGAAGATGATCGAGGACCAGTGCTGCGACGACAACATCGAG
ATGAAGCCCAAGTCCTTGGCCAGTTGGATGACCCGTGTGCTCTACAACCG
TCGTTCGCGGATGAACCCCCTCTACATTGACGTGGTTGTCGGCGGCGTGG
ACAACGAGGGGACTCCGTACCTGGCCAACGTGGATCTCCGTGGACGATCC
TACGAGGACTACGTGGTGGCCACTGGTTTTGCCCGCCATTTGGCCGTTCC
GCTGGTCCGTGAGAAGAAGCCCAAGGACAGGGACTTTACCGCCGTAGAAG
CTTCCGAACTGATCCGCACATGCATGGAGGTGCTTTACTACCGCGATACT
CGTAATATTTCCCAATACACTGTGGGCGTGTGCAGCGTCAACGGATGCGG
CGTGGAGGGGCCCTTCCAAGTTAACGAAAACTGGACATTCGCCGAAACCA
TAAAGGGATACTAGAGCCTCCGATTCTGAATGAACTTAGTTTAGGTCTAG
CTCGGCGGTTTTGCATTAAAAAAAAACACTTGTCTAAGGATATGTGGTTA
CATGATTTATTAAAAATAAATGTGGCTGAAAATAAAAAAAAAAAAAAAAA
AAAA

LD24633.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:06:15
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta7-RA 1335 Prosbeta7-RA 233..1217 1..985 4925 100 Plus
Prosbeta7-RB 1335 Prosbeta7-RB 233..1217 1..985 4925 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:56:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1183018..1183523 711..206 2515 99.8 Minus
chr3R 27901430 chr3R 1182675..1182947 983..711 1365 100 Minus
chr3R 27901430 chr3R 1183587..1183795 209..1 1045 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:15:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5357355..5357860 711..206 2515 99.8 Minus
3R 32079331 3R 5357010..5357284 985..711 1375 100 Minus
3R 32079331 3R 5357924..5358132 209..1 1045 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5098186..5098691 711..206 2515 99.8 Minus
3R 31820162 3R 5097841..5098115 985..711 1375 100 Minus
3R 31820162 3R 5098755..5098963 209..1 1045 100 Minus
Blast to na_te.dros performed 2019-03-15 15:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dtei\I-element 5386 Dtei\I-element DTEII 5386bp 3499..3584 965..883 133 66.3 Minus
flea 5034 flea DMBLPP 5034bp Derived from Z27119 (g415797) (Rel. 50, Last updated, Version 6). 4427..4500 392..461 109 63.5 Plus

LD24633.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:57:23 Download gff for LD24633.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1182675..1182946 712..983 100 <- Minus
chr3R 1183018..1183519 210..711 100 <- Minus
chr3R 1183587..1183795 1..209 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:02:59 Download gff for LD24633.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta4-RB 1..807 58..864 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:48:50 Download gff for LD24633.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta7-RB 1..807 58..864 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:46:16 Download gff for LD24633.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta7-RA 1..807 58..864 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:41:24 Download gff for LD24633.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta4-RB 1..807 58..864 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:21:05 Download gff for LD24633.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta7-RA 1..807 58..864 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:25:37 Download gff for LD24633.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta4-RB 42..1024 1..983 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:48:50 Download gff for LD24633.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta7-RB 42..1024 1..983 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:46:16 Download gff for LD24633.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta7-RA 233..1215 1..983 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:41:24 Download gff for LD24633.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta4-RB 42..1024 1..983 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:21:05 Download gff for LD24633.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta7-RA 233..1215 1..983 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:57:23 Download gff for LD24633.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5357012..5357283 712..983 100 <- Minus
3R 5357355..5357856 210..711 100 <- Minus
3R 5357924..5358132 1..209 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:57:23 Download gff for LD24633.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5357012..5357283 712..983 100 <- Minus
3R 5357355..5357856 210..711 100 <- Minus
3R 5357924..5358132 1..209 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:57:23 Download gff for LD24633.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5357012..5357283 712..983 100 <- Minus
3R 5357355..5357856 210..711 100 <- Minus
3R 5357924..5358132 1..209 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:46:16 Download gff for LD24633.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1183077..1183578 210..711 100 <- Minus
arm_3R 1183646..1183854 1..209 100   Minus
arm_3R 1182734..1183005 712..983 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:13:41 Download gff for LD24633.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5097843..5098114 712..983 100 <- Minus
3R 5098186..5098687 210..711 100 <- Minus
3R 5098755..5098963 1..209 100   Minus

LD24633.pep Sequence

Translation from 57 to 863

> LD24633.pep
MLNNYNSLAQPMWQNGPAPGEFYNFTGGQTPVQQLPRELTTMGPYGTKHS
TASSTTGTSVLGIRYDSGVMLAADTLVSYGSMARYQNIERVFKVNKNILL
GGSGDFADIQSIKRNIDQKMIEDQCCDDNIEMKPKSLASWMTRVLYNRRS
RMNPLYIDVVVGGVDNEGTPYLANVDLRGRSYEDYVVATGFARHLAVPLV
REKKPKDRDFTAVEASELIRTCMEVLYYRDTRNISQYTVGVCSVNGCGVE
GPFQVNENWTFAETIKGY*

LD24633.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:38:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20703-PA 268 GF20703-PA 1..268 1..268 1121 75.4 Plus
Dana\GF23325-PA 265 GF23325-PA 4..265 3..268 951 63.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:38:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11060-PA 268 GG11060-PA 1..268 1..268 1374 93.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:38:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22652-PA 265 GH22652-PA 1..265 1..268 1139 76.9 Plus
Dgri\GH16568-PA 213 GH16568-PA 2..213 55..268 761 65.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta7-PB 268 CG12000-PB 1..268 1..268 1417 100 Plus
Prosbeta7-PA 268 CG12000-PA 1..268 1..268 1417 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:38:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10207-PA 266 GI10207-PA 1..266 1..268 1109 73.9 Plus
Dmoj\GI10953-PA 448 GI10953-PA 233..448 53..268 610 50 Plus
Dmoj\GI12054-PA 322 GI12054-PA 40..233 55..245 155 27.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:38:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22187-PA 268 GL22187-PA 1..268 1..268 1142 79.1 Plus
Dper\GL19635-PA 246 GL19635-PA 33..240 55..262 579 51.9 Plus
Dper\GL25789-PA 242 GL25789-PA 11..232 46..267 534 45.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:38:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11323-PA 268 GA11323-PA 1..268 1..268 1142 79.1 Plus
Dpse\GA26039-PA 246 GA26039-PA 31..240 53..262 582 51.9 Plus
Dpse\GA25445-PA 242 GA25445-PA 22..232 57..267 531 47.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:38:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10644-PA 268 GM10644-PA 1..268 1..268 1431 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:38:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19625-PA 268 GD19625-PA 1..268 1..268 1419 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:38:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10047-PA 265 GJ10047-PA 1..265 1..268 1117 75 Plus
Dvir\GJ18283-PA 1176 GJ18283-PA 59..254 46..241 655 58.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14279-PA 267 GK14279-PA 1..267 1..268 1130 77.2 Plus
Dwil\GK19842-PA 250 GK19842-PA 37..250 54..268 654 54 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25292-PA 268 GE25292-PA 1..268 1..268 1390 94.4 Plus

LD24633.hyp Sequence

Translation from 57 to 863

> LD24633.hyp
MLNNYNSLAQPMWQNGPAPGEFYNFTGGQTPVQQLPRELTTMGPYGTKHS
TASSTTGTSVLGIRYDSGVMLAADTLVSYGSMARYQNIERVFKVNKNILL
GGSGDFADIQSIKRNIDQKMIEDQCCDDNIEMKPKSLASWMTRVLYNRRS
RMNPLYIDVVVGGVDNEGTPYLANVDLRGRSYEDYVVATGFARHLAVPLV
REKKPKDRDFTAVEASELIRTCMEVLYYRDTRNISQYTVGVCSVNGCGVE
GPFQVNENWTFAETIKGY*

LD24633.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:29:15
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta7-PB 268 CG12000-PB 1..268 1..268 1417 100 Plus
Prosbeta7-PA 268 CG12000-PA 1..268 1..268 1417 100 Plus