BDGP Sequence Production Resources |
Search the DGRC for LD24657
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 246 |
Well: | 57 |
Vector: | pOT2 |
Associated Gene/Transcript | CG3776-RA |
Protein status: | LD24657.pep: gold |
Preliminary Size: | 2200 |
Sequenced Size: | 946 |
Gene | Date | Evidence |
---|---|---|
CG3776 | 2001-01-01 | Release 2 assignment |
CG3776 | 2001-12-12 | Blastp of sequenced clone |
CG3776 | 2003-01-01 | Sim4 clustering to Release 3 |
Jhebp29 | 2008-04-29 | Release 5.5 accounting |
Jhebp29 | 2008-08-15 | Release 5.9 accounting |
Jhebp29 | 2008-12-18 | 5.12 accounting |
946 bp (946 high quality bases) assembled on 2001-12-12
GenBank Submission: AY070543
> LD24657.complete TTCAGAGTGCAATTTCTGCAATGCAGCACACGCTTATACGCTGCTTGGGC ATGGCCCGGATATCCCTGATGCGTTTGCAGCCCAGACCCACAGTGGCAGC CTCCGGGGGACAGGAAGCTGGGTCCATCTCGAAGCCAACACAACCGGTCA GTCGGTCTTTCGCCTCGCTGCCGCAGGAGCAAGACAAGAAGGAGCAGAAT GCCAGAGAGAGCCTTAACCGCCTGCCTCGCCTAATGGACTTTCCAGAGAT CGTGTGGCCATCGGCGCTTAACTCGTTAAAAAATTGGATCACCATACAGT TCATAATTCGACCCTACTTCGACAGCGAGTTTCAACTCAAGGACTTCATA TACGGCGCCAAGCAAGCGCTGCAGGTAGTATCCTCAAAACTGATGGGCGG CGACTTAGACTCCCTGGACAATCTTGTCTCGCCCGAGGCGATCGCAGAGC TTAGACCGGTAATCCAAAAACTGTCAATGACGCAACGGAGGCAGCTAGAA ATCAAGGAGAGCGACATATACCTCAGCTTTCCCTATCAGGTAGGTATTAT GTTTGACGATGCAAACGACAAGCTGCAGAAGCGTTTCGTAGAGATCACCA TGGTGTTTCACGTAATGCGTGGTCTATCCGAGATGCGGGAACGCGGCGAG GAAATACCCTGGAACATGGGGACCCTTCCCGAGTACCAGGATAAGGTTTT CATCTGCAACTACCGTTTTGTAAAGGAGTTCACCGCTGGACACCAATCGG ACTGGACCGTAAATGTGGCCAACCAGTTTAGGGCCATCGACCTTATTAAC GAGACCATATAACATCGGCCCATGGCTACCATCATCCGCGCTGTTCGCCG ACTCATAGCATATATTGGCGTAAGCCACCGCCTTCGTTGGAATAAAAGTT TCGTTTTCCGCATTTAGGTATAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Jhebp29.c | 1009 | Jhebp29.c | 84..1009 | 1..926 | 4630 | 100 | Plus |
Jhebp29-RA | 1093 | Jhebp29-RA | 168..1093 | 1..926 | 4630 | 100 | Plus |
Jhebp29.a | 925 | Jhebp29.a | 54..592 | 1..539 | 2695 | 100 | Plus |
Jhebp29.a | 925 | Jhebp29.a | 591..925 | 592..926 | 1675 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 20855794..20856169 | 1..376 | 1880 | 100 | Plus |
chr2R | 21145070 | chr2R | 20856218..20856516 | 373..671 | 1495 | 100 | Plus |
chr2R | 21145070 | chr2R | 20856571..20856822 | 670..921 | 1245 | 99.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 24969827..24970202 | 1..376 | 1880 | 100 | Plus |
2R | 25286936 | 2R | 24970251..24970549 | 373..671 | 1495 | 100 | Plus |
2R | 25286936 | 2R | 24970604..24970861 | 670..927 | 1290 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 24971026..24971401 | 1..376 | 1880 | 100 | Plus |
2R | 25260384 | 2R | 24971450..24971748 | 373..671 | 1495 | 100 | Plus |
2R | 25260384 | 2R | 24971803..24972060 | 670..927 | 1290 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 20855794..20856167 | 1..374 | 100 | -> | Plus |
chr2R | 20856220..20856515 | 375..670 | 100 | -> | Plus |
chr2R | 20856572..20856822 | 671..921 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Jhebp29-RA | 1..792 | 21..812 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3776-RA | 1..792 | 21..812 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3776-RA | 1..792 | 21..812 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Jhebp29-RA | 1..792 | 21..812 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3776-RA | 1..792 | 21..812 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Jhebp29-RA | 55..975 | 1..921 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3776-RA | 55..975 | 1..921 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3776-RA | 17..937 | 1..921 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Jhebp29-RA | 55..975 | 1..921 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3776-RA | 17..937 | 1..921 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24969827..24970200 | 1..374 | 100 | -> | Plus |
2R | 24970253..24970548 | 375..670 | 100 | -> | Plus |
2R | 24970605..24970855 | 671..921 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24969827..24970200 | 1..374 | 100 | -> | Plus |
2R | 24970253..24970548 | 375..670 | 100 | -> | Plus |
2R | 24970605..24970855 | 671..921 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24969827..24970200 | 1..374 | 100 | -> | Plus |
2R | 24970253..24970548 | 375..670 | 100 | -> | Plus |
2R | 24970605..24970855 | 671..921 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 20857350..20857723 | 1..374 | 100 | -> | Plus |
arm_2R | 20857776..20858071 | 375..670 | 100 | -> | Plus |
arm_2R | 20858128..20858378 | 671..921 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24971044..24971417 | 1..374 | 100 | -> | Plus |
2R | 24971470..24971765 | 375..670 | 100 | -> | Plus |
2R | 24971822..24972072 | 671..921 | 100 | Plus |
Translation from 2 to 811
> LD24657.hyp QSAISAMQHTLIRCLGMARISLMRLQPRPTVAASGGQEAGSISKPTQPVS RSFASLPQEQDKKEQNARESLNRLPRLMDFPEIVWPSALNSLKNWITIQF IIRPYFDSEFQLKDFIYGAKQALQVVSSKLMGGDLDSLDNLVSPEAIAEL RPVIQKLSMTQRRQLEIKESDIYLSFPYQVGIMFDDANDKLQKRFVEITM VFHVMRGLSEMRERGEEIPWNMGTLPEYQDKVFICNYRFVKEFTAGHQSD WTVNVANQFRAIDLINETI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG3776-PB | 263 | CG3776-PB | 1..263 | 7..269 | 1353 | 100 | Plus |
CG3776-PA | 263 | CG3776-PA | 1..263 | 7..269 | 1353 | 100 | Plus |
CG3776-PC | 201 | CG3776-PC | 1..173 | 7..179 | 874 | 100 | Plus |
Translation from 20 to 811
> LD24657.pep MQHTLIRCLGMARISLMRLQPRPTVAASGGQEAGSISKPTQPVSRSFASL PQEQDKKEQNARESLNRLPRLMDFPEIVWPSALNSLKNWITIQFIIRPYF DSEFQLKDFIYGAKQALQVVSSKLMGGDLDSLDNLVSPEAIAELRPVIQK LSMTQRRQLEIKESDIYLSFPYQVGIMFDDANDKLQKRFVEITMVFHVMR GLSEMRERGEEIPWNMGTLPEYQDKVFICNYRFVKEFTAGHQSDWTVNVA NQFRAIDLINETI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13356-PA | 267 | GF13356-PA | 3..266 | 1..262 | 1165 | 83.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23023-PA | 267 | GG23023-PA | 1..266 | 1..262 | 1330 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19839-PA | 226 | GH19839-PA | 1..225 | 36..262 | 978 | 78 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG3776-PB | 263 | CG3776-PB | 1..263 | 1..263 | 1353 | 100 | Plus |
CG3776-PA | 263 | CG3776-PA | 1..263 | 1..263 | 1353 | 100 | Plus |
CG3776-PC | 201 | CG3776-PC | 1..173 | 1..173 | 874 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20427-PA | 226 | GI20427-PA | 10..225 | 45..262 | 978 | 80.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11203-PA | 248 | GL11203-PA | 1..247 | 1..262 | 1087 | 77.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA17681-PA | 248 | GA17681-PA | 1..247 | 1..262 | 1085 | 77.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11918-PA | 267 | GM11918-PA | 1..266 | 1..262 | 1356 | 96.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11914-PA | 267 | GD11914-PA | 1..266 | 1..262 | 1369 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20100-PA | 227 | GJ20100-PA | 11..226 | 45..262 | 975 | 80 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19646-PA | 242 | GK19646-PA | 1..241 | 1..262 | 1004 | 73 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE14459-PA | 267 | GE14459-PA | 1..266 | 1..262 | 1328 | 94 | Plus |