Clone LD24657 Report

Search the DGRC for LD24657

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:246
Well:57
Vector:pOT2
Associated Gene/TranscriptCG3776-RA
Protein status:LD24657.pep: gold
Preliminary Size:2200
Sequenced Size:946

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3776 2001-01-01 Release 2 assignment
CG3776 2001-12-12 Blastp of sequenced clone
CG3776 2003-01-01 Sim4 clustering to Release 3
Jhebp29 2008-04-29 Release 5.5 accounting
Jhebp29 2008-08-15 Release 5.9 accounting
Jhebp29 2008-12-18 5.12 accounting

Clone Sequence Records

LD24657.complete Sequence

946 bp (946 high quality bases) assembled on 2001-12-12

GenBank Submission: AY070543

> LD24657.complete
TTCAGAGTGCAATTTCTGCAATGCAGCACACGCTTATACGCTGCTTGGGC
ATGGCCCGGATATCCCTGATGCGTTTGCAGCCCAGACCCACAGTGGCAGC
CTCCGGGGGACAGGAAGCTGGGTCCATCTCGAAGCCAACACAACCGGTCA
GTCGGTCTTTCGCCTCGCTGCCGCAGGAGCAAGACAAGAAGGAGCAGAAT
GCCAGAGAGAGCCTTAACCGCCTGCCTCGCCTAATGGACTTTCCAGAGAT
CGTGTGGCCATCGGCGCTTAACTCGTTAAAAAATTGGATCACCATACAGT
TCATAATTCGACCCTACTTCGACAGCGAGTTTCAACTCAAGGACTTCATA
TACGGCGCCAAGCAAGCGCTGCAGGTAGTATCCTCAAAACTGATGGGCGG
CGACTTAGACTCCCTGGACAATCTTGTCTCGCCCGAGGCGATCGCAGAGC
TTAGACCGGTAATCCAAAAACTGTCAATGACGCAACGGAGGCAGCTAGAA
ATCAAGGAGAGCGACATATACCTCAGCTTTCCCTATCAGGTAGGTATTAT
GTTTGACGATGCAAACGACAAGCTGCAGAAGCGTTTCGTAGAGATCACCA
TGGTGTTTCACGTAATGCGTGGTCTATCCGAGATGCGGGAACGCGGCGAG
GAAATACCCTGGAACATGGGGACCCTTCCCGAGTACCAGGATAAGGTTTT
CATCTGCAACTACCGTTTTGTAAAGGAGTTCACCGCTGGACACCAATCGG
ACTGGACCGTAAATGTGGCCAACCAGTTTAGGGCCATCGACCTTATTAAC
GAGACCATATAACATCGGCCCATGGCTACCATCATCCGCGCTGTTCGCCG
ACTCATAGCATATATTGGCGTAAGCCACCGCCTTCGTTGGAATAAAAGTT
TCGTTTTCCGCATTTAGGTATAAAAAAAAAAAAAAAAAAAAAAAAA

LD24657.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:49:29
Subject Length Description Subject Range Query Range Score Percent Strand
Jhebp29.c 1009 Jhebp29.c 84..1009 1..926 4630 100 Plus
Jhebp29-RA 1093 Jhebp29-RA 168..1093 1..926 4630 100 Plus
Jhebp29.a 925 Jhebp29.a 54..592 1..539 2695 100 Plus
Jhebp29.a 925 Jhebp29.a 591..925 592..926 1675 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20855794..20856169 1..376 1880 100 Plus
chr2R 21145070 chr2R 20856218..20856516 373..671 1495 100 Plus
chr2R 21145070 chr2R 20856571..20856822 670..921 1245 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:16:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24969827..24970202 1..376 1880 100 Plus
2R 25286936 2R 24970251..24970549 373..671 1495 100 Plus
2R 25286936 2R 24970604..24970861 670..927 1290 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:15:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24971026..24971401 1..376 1880 100 Plus
2R 25260384 2R 24971450..24971748 373..671 1495 100 Plus
2R 25260384 2R 24971803..24972060 670..927 1290 100 Plus
Blast to na_te.dros performed on 2019-03-16 10:29:27 has no hits.

LD24657.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:30:21 Download gff for LD24657.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20855794..20856167 1..374 100 -> Plus
chr2R 20856220..20856515 375..670 100 -> Plus
chr2R 20856572..20856822 671..921 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:03:06 Download gff for LD24657.complete
Subject Subject Range Query Range Percent Splice Strand
Jhebp29-RA 1..792 21..812 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:18:17 Download gff for LD24657.complete
Subject Subject Range Query Range Percent Splice Strand
CG3776-RA 1..792 21..812 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:06:05 Download gff for LD24657.complete
Subject Subject Range Query Range Percent Splice Strand
CG3776-RA 1..792 21..812 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:44:25 Download gff for LD24657.complete
Subject Subject Range Query Range Percent Splice Strand
Jhebp29-RA 1..792 21..812 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:10:26 Download gff for LD24657.complete
Subject Subject Range Query Range Percent Splice Strand
CG3776-RA 1..792 21..812 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:51:15 Download gff for LD24657.complete
Subject Subject Range Query Range Percent Splice Strand
Jhebp29-RA 55..975 1..921 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:18:17 Download gff for LD24657.complete
Subject Subject Range Query Range Percent Splice Strand
CG3776-RA 55..975 1..921 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:06:05 Download gff for LD24657.complete
Subject Subject Range Query Range Percent Splice Strand
CG3776-RA 17..937 1..921 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:44:25 Download gff for LD24657.complete
Subject Subject Range Query Range Percent Splice Strand
Jhebp29-RA 55..975 1..921 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:10:26 Download gff for LD24657.complete
Subject Subject Range Query Range Percent Splice Strand
CG3776-RA 17..937 1..921 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:30:21 Download gff for LD24657.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24969827..24970200 1..374 100 -> Plus
2R 24970253..24970548 375..670 100 -> Plus
2R 24970605..24970855 671..921 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:30:21 Download gff for LD24657.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24969827..24970200 1..374 100 -> Plus
2R 24970253..24970548 375..670 100 -> Plus
2R 24970605..24970855 671..921 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:30:21 Download gff for LD24657.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24969827..24970200 1..374 100 -> Plus
2R 24970253..24970548 375..670 100 -> Plus
2R 24970605..24970855 671..921 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:06:05 Download gff for LD24657.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20857350..20857723 1..374 100 -> Plus
arm_2R 20857776..20858071 375..670 100 -> Plus
arm_2R 20858128..20858378 671..921 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:20:40 Download gff for LD24657.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24971044..24971417 1..374 100 -> Plus
2R 24971470..24971765 375..670 100 -> Plus
2R 24971822..24972072 671..921 100   Plus

LD24657.hyp Sequence

Translation from 2 to 811

> LD24657.hyp
QSAISAMQHTLIRCLGMARISLMRLQPRPTVAASGGQEAGSISKPTQPVS
RSFASLPQEQDKKEQNARESLNRLPRLMDFPEIVWPSALNSLKNWITIQF
IIRPYFDSEFQLKDFIYGAKQALQVVSSKLMGGDLDSLDNLVSPEAIAEL
RPVIQKLSMTQRRQLEIKESDIYLSFPYQVGIMFDDANDKLQKRFVEITM
VFHVMRGLSEMRERGEEIPWNMGTLPEYQDKVFICNYRFVKEFTAGHQSD
WTVNVANQFRAIDLINETI*

LD24657.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG3776-PB 263 CG3776-PB 1..263 7..269 1353 100 Plus
CG3776-PA 263 CG3776-PA 1..263 7..269 1353 100 Plus
CG3776-PC 201 CG3776-PC 1..173 7..179 874 100 Plus

LD24657.pep Sequence

Translation from 20 to 811

> LD24657.pep
MQHTLIRCLGMARISLMRLQPRPTVAASGGQEAGSISKPTQPVSRSFASL
PQEQDKKEQNARESLNRLPRLMDFPEIVWPSALNSLKNWITIQFIIRPYF
DSEFQLKDFIYGAKQALQVVSSKLMGGDLDSLDNLVSPEAIAELRPVIQK
LSMTQRRQLEIKESDIYLSFPYQVGIMFDDANDKLQKRFVEITMVFHVMR
GLSEMRERGEEIPWNMGTLPEYQDKVFICNYRFVKEFTAGHQSDWTVNVA
NQFRAIDLINETI*

LD24657.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13356-PA 267 GF13356-PA 3..266 1..262 1165 83.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23023-PA 267 GG23023-PA 1..266 1..262 1330 94.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19839-PA 226 GH19839-PA 1..225 36..262 978 78 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG3776-PB 263 CG3776-PB 1..263 1..263 1353 100 Plus
CG3776-PA 263 CG3776-PA 1..263 1..263 1353 100 Plus
CG3776-PC 201 CG3776-PC 1..173 1..173 874 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20427-PA 226 GI20427-PA 10..225 45..262 978 80.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11203-PA 248 GL11203-PA 1..247 1..262 1087 77.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17681-PA 248 GA17681-PA 1..247 1..262 1085 77.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11918-PA 267 GM11918-PA 1..266 1..262 1356 96.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11914-PA 267 GD11914-PA 1..266 1..262 1369 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20100-PA 227 GJ20100-PA 11..226 45..262 975 80 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19646-PA 242 GK19646-PA 1..241 1..262 1004 73 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14459-PA 267 GE14459-PA 1..266 1..262 1328 94 Plus